SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_159520 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_159520
Domain Number 1 Region: 1-167
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.07e-17
Family Motor proteins 0.00035
Further Details:      
 
Domain Number 2 Region: 197-307
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000018
Family Myosin rod fragments 0.0022
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_159520
Domain Number - Region: 313-403
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_159520
Sequence length 404
Comment | organism=Entamoeba_invadens_IP1 | product=myosin-7, putative | location=EINV_533:4121-5726(+) | length=404
Sequence
MKKLRMTTPHYIIYVLLNTQKRIRYFIDSTVLKQLRCNGVLEGIRITRLGYPNRIIYNEF
LKRYFFLGTNINKKSSGAMPVVKDLMKLFCEKYKKQAKSEHWQIQNRVTELVGGLHVCVK
AISQRKLIEQKRNEQIAINVIQDTIHTWYQFRNWVWFRLLQKVQPTLKRRRKLVDKKNKK
REVAEKALSEMKIKNVDLEALVEELKEDIEPKKVSLDKADIKSREEQEHIEELQADNQRL
QDGIIEHKTTIAKKDSVITELNKDIEDMESEISDLKKQLVAEEDNSKNLETQLHEKEDDI
ADLEKQTKTAALTSAKNANDKKISLLNSEKDELEDKNRKLDELIKKIEDGLNDSDMLKAQ
KADYEAQIQALKDDMEKTGKDLAGAKSNMHQKDVEINNLNEQLA
Download sequence
Identical sequences L7FLI4
jCVI|EIN_159520 XP_004253584.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]