SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_159530 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_159530
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000012
Family Myosin rod fragments 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_159530
Sequence length 160
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_533:5899-6451(+) | length=160
Sequence
MKKLKAENDEIKEKVKNLANDKDQLSSEKKKLQDQYDQLNNLVSEHEDETNNLNGSIKKL
QRDLEANNTELTELRDRTAKDKKKIADLEQKVQDLEDRPVGTSNIDQTEVIKRDNQIAYL
ENEVAALKDQNTQLDAAKKNMKSDGFGRQSGGREDCRGPI
Download sequence
Identical sequences L7FKS1
jCVI|EIN_159530 XP_004253585.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]