SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_159540 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_159540
Domain Number - Region: 36-151
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00034
Family Myosin rod fragments 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_159540
Sequence length 167
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_533:6560-7063(+) | length=167
Sequence
MLNARIAEIQTQPDEERQKADSADAVRKADSPKELEKERAIKQEADKETQRLRVKVTNSE
AKLADAGATGASIAKLKAKYETELEGIETEKVEAQNLATEPKKQAKQYARKVEEAERKLA
EFEQKESTINTHIGKTQSDLKKTQQSVRDGELRIVELEDRSENLVKI
Download sequence
Identical sequences L7FKM4
jCVI|EIN_159540 XP_004253586.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]