SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_160620 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_160620
Domain Number 1 Region: 387-621
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 9.81e-20
Family Serum paraoxonase/arylesterase 1, PON1 0.067
Further Details:      
 
Domain Number 2 Region: 135-181
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000183
Family B-box zinc-binding domain 0.0025
Further Details:      
 
Domain Number 3 Region: 6-75
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000193
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_160620
Domain Number - Region: 322-357
Classification Level Classification E-value
Superfamily E set domains 0.00574
Family Filamin repeat (rod domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_160620
Sequence length 632
Comment | organism=Entamoeba_invadens_IP1 | product=nhl repeat-containing protein, putative | location=EINV_535:135274-137172(-) | length=632
Sequence
MLRHTLRDSYHCEFCDGYFTVPSLPKVLPCFHVICRDCILSLMKVQKSYNTYSDTENELY
CPKCKKYIHLPPNAPDILPTSYKRIKTSYEASRCFDSPNCYSSSFGYCFDCTTTFCIEHS
KTHIKRKHVVEIFKPGKFCLTHMKAAEMYCYTCQSVICGVCRASLHSSHTVSSLSLFYSF
FMKDITLPKLYQNLRKVANCVTRITSVMAITDASEVSNILHDINFAFRMDPNPFCRTNVL
SVFILPINATKKFSICELCGSSSQRLEIVVKKATPIPRPRTVGYSETPLIKFYDDMSPMS
PLPTNESVRLGGELSIEVNEQEVVFIGKRVGDVLVEIRSGGVEIDNSPLRVRVCPEVKSF
STSVTSDKHQVDIKYLNIVGKGYGIVDSGNDCVKIIGTDFVIFGGRGSGKGQFKEPSGLC
VGTHDKEEYIWVVDKGNSRIQMFNKGRFVRSIQREGKGKLDSPTSCVYVASEHLLYVTDT
LNDRIALFGVDGSFVKTICDDLNHPLDIKNITVNKELMFVVTDTGNHRIVLINKTGTILL
SKGGVGEERRGHFIHPTHLAIDPKKNEIYVTEGKSIIQKFNYNLDYLQTYNFHIGEITAF
YYNTTTDVLVVVGTDSDEVYSYTQELMDYFVV
Download sequence
Identical sequences A0A0A1U1E1
XP_004254616.1.21224 jCVI|EIN_160620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]