SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_165810 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_165810
Domain Number 1 Region: 5-222
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.05e-62
Family Calponin-homology domain, CH-domain 0.00023
Further Details:      
 
Domain Number 2 Region: 326-450
Classification Level Classification E-value
Superfamily E set domains 2.14e-18
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 3 Region: 231-335
Classification Level Classification E-value
Superfamily E set domains 1e-16
Family Filamin repeat (rod domain) 0.0017
Further Details:      
 
Domain Number 4 Region: 458-539
Classification Level Classification E-value
Superfamily E set domains 0.000000000000867
Family Filamin repeat (rod domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_165810
Sequence length 539
Comment | organism=Entamoeba_invadens_IP1 | product=actin binding protein, putative | location=EINV_553:101627-103246(+) | length=539
Sequence
MAEKQPQWVMTQKKTFTKWANVQLAGTYVINDVEKDLSDGIILISLFEALTKKKVSFKFN
KQPKMKIAKLENLEQALKFIVADGIKLVNIDAQNIFEGDLKLILGLLWVLILKYQIAANK
MDASTQALLDWVNSKIAPKKITNFKSDWNTGDTLNELIKALEPEFIDMGESENKETGAER
IKYGQQIAEDKMNIPAIIDAADMALPEPDDLSVMAYVSYFRHYEAEKAKTAADPAKTYAE
GPGVEGGCKTCDTAKFVVHALKSNGAPYTLEKVPFEVKITDPEGKEIEPKVERGENGLFN
VDYMPTKPGKYNVSVCIQSAETNKIEPIKGSPYTPEILAGISGANCLVSGPGVDGGDELD
DCNDAEFTIQAKDIEGNEIKEGGAEFEVKVHDPSGEDMECEVKDNGDGTYSCKYAPDCPG
VYSVDIDLKNDTHDKVGKAPYEVSVGEGVDNNSTGVDFFQFTINARTKKGQAVKPGNATF
SVKIVHESGTEIPQENIKIENLEEAKYRVTYKTGETGDYTIHCLLNNRDIKGSPWVQTC
Download sequence
Identical sequences A0A0A1TWY3 S0B454
jCVI|EIN_165810 XP_004185109.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]