SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_166230 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_166230
Domain Number - Region: 693-806
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000706
Family Myosin rod fragments 0.0071
Further Details:      
 
Domain Number - Region: 814-1056
Classification Level Classification E-value
Superfamily Tropomyosin 0.000915
Family Tropomyosin 0.0055
Further Details:      
 
Domain Number - Region: 1064-1179
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00235
Family Myosin rod fragments 0.0039
Further Details:      
 
Domain Number - Region: 1206-1470
Classification Level Classification E-value
Superfamily Tropomyosin 0.0124
Family Tropomyosin 0.0021
Further Details:      
 
Domain Number - Region: 1873-1940
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0994
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_166230
Sequence length 2622
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein, conserved | location=EINV_553:225742-233610(-) | length=2622
Sequence
MSRPKIQLGSRKKTEKPSEQIGGVPIEPEHPVEEQPVVGHARSSTFLATNRKATFGEKVK
QEEPPKVGSPEKRGFGSNTGAPKVTKDTERKNFLGQKHTKTPSQTSETPLQNAETNSKEE
EPKQNEELKEEGKPVKRMSFLGRRQQTNGPKKEHSQLLETLKKEEEKPTTYTSQGPNVNE
LETNNELKTLKEKLEETQKKCDTQEEQLNAKIQAELELTKTVEELNAKYTTLQTEKETTE
KEKECEIEKLKEQNKSENEKIENELKKMKEEKERIENEFEGMKGEKEKLMNDMANGDEMT
SRMKDEIDKEKENNKKLKEENKAQRESISELTTAKLNVETTLTQKITQLETNEKIYNELK
TNYNTIQSQLTALNEQNETLKKQLDTAITEKEKLLNDISSGSDLSTKLNQEIESQKEINN
KTNEELKLTIQKLEETQQQKVGCETEIKNLQETISQEKENNTKVVEELVRVKSERENLEK
QNNELTTNKQQLDEKVASLEKHVEQQNNEMENIKKENDDLKSTKQQNEATLAEKILQFAN
IENAQKELQDALNKEKSERENLTNENKSLNEELNNTKEEKCKILSELNALKGEKENVTNE
LKTIKEELENQKKSNVNTIGELERLKEAKNSVDEQLQMVRSEKEKLLGDLANGSDSASQL
NDELNKEKENNRKLEEQNKEKDQSIQTQQTQIEEISKQKISCETQIVALQAEKENLNTEI
VTQKDNVTRLSGEIETLKKSLEDIENQRNDLTTQKENLEQNTMKLENTLNDKSKQVDELQ
NEINELKKVKEQIESEKKSVETTMAEKVALLMTTEKTVQEFNNENEQLKKEKENVLNELN
TTKEQKSHLEEQIKTMENEKEKLLSDLSNGSDSSKKLNEEIEKQKEQSRKLEEQNNEISQ
RLNTTLNELNELTQQKASCETQINSLQTEKQNLLNQISEHNEKYDKMSEEFNLLTRCKED
LEKQNIELTTLKQNLENNNKQLEGDIKEQKRELEELNQTNVQIKETLSEKNSLITNNEKI
ISELQMEVKTEKNNKEMVETELNKIKEEKEMLLKDLSNGSDLSSKLNEKIQNEKNRNTKL
ENEIQTQNDKINELQKLKDQTNEDLNKMTEKVKEMENGLISSKETIDQLNQQNSSQSNQM
SKLKTDFDELNTMNTKLENTLSDLKNENQKLKTSKIDLENTNLKIEQNLKEVGRKVEELT
SENLKINENAKNLELSLQNEKDENEKLEKQISDEKEEKTKFMKELENNKKEISRSKDENE
NLKKENSSLSCENEKIETAKNEIENSLKNLKTEKQKVEEILQTTQTENKKITEKLQKIEE
EKSLSENKIKELNNEFESLKNEKNKIEDKCTELTNEVQTLNTSLSTTTENLNLSKTEIEK
LHNELENLNTSKNGIEKEKNRIASELNDSKSQNERLSIQIAENQKRLTEMQKSIENGENE
TIISLNGTITELTEKEKKSQDKITQLQSEIGQKNIVVEEIKMEIETFKNKNEELEKLKKE
NEEYNNKLETEKESLKNKVNEIEKSYNIEKEEHKKSREELEKEKTEKRKIEEEKKTVEEV
LEKNKNEIFNQNNENNKTLQNLKNLQEILEEKENEMAKQKNENQKIEEKNKNCILEIEKL
KSENEKIENDVTSGKELVAKLSEDLEKIKKEKQRTESELITLKEQKEKSEENCVKTSEEL
KNTKDENVKIANEMSEVKMRLQRANEELENTKNEKEKLMKDLTSCGDVTQRLNEEIKKLT
DEREEVKISLKNKIEEREEIEKRLNQLKEEKENDMKRLSEELGKEKEKRESAERENNTLK
EENDKMNKDKENMMIELTKTRDEFEGMKGEKEKLMNDMANGDEMTSRMKDEIDKEKENNK
KLKEENKAQRESISELTTAKLNVETTLTQKITQLETNEKIYNELKTNYNTIQSQLTALNE
QNETLKKQLDSTEDKNNNITSELLTTKEELNKVNVEREKICNTLESIQQEKNKIEEQLNL
VSSEKEKLLGDLAHGSDSSQRLNEELQTEKETNRRLAEEVLNAKQAVENVKNEIDKIRQE
KSEIDLQRTETLSALEKTRNELSTSELEMTRLKEVLAESRTANEEHEREKEKLREEVDHL
ETNNKRLEEEQIAMKKELLNGSDGASRLTNEVEKLNNEKTEIEEVNKKLQEEMKEVRREK
EMIGMQLEEAKNENEMIRKDGERSESRMNEMKKSLEEVQRENETMRNRIELDEGERKKLQ
EEVQHIRNEKEELLDERDDMEKDKETLNTTIEGLVGSNKRLEEEMKKMREENERKEKEII
EENNQVITENNELQDELEKLQQRITDMKNQHEATLKSVALDQNKVGEAKKQLEEKIKALE
KENAELNQDLDDEEEELNAMQSELDKFKMERANIEKQAKDQKREVSSRLESTEMEKKSLE
DKLSEVEKELSRVNSTKNKLEKDKSALEQNLDNMVNKMSNMVDKDVLGKLTRQLEEEKMA
KEKSVEEYEKRRRENEKDFEKLQQLYNALMNERAQMIEKTEHVERENEDLKTKVKDTQEL
GKVKWENGTLKTENETLKQQLLKENNFNLKSDDEIFVSIEYLFFDALWVPLKMEILEEEI
EEDTQRRLNMSELRLFKACCKQTTFNNYRNWMMRFVNGEINV
Download sequence
Identical sequences A0A0A1TWY9
jCVI|EIN_166230 XP_004185151.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]