SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_176700 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_176700
Domain Number - Region: 54-125
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0217
Family Myosin rod fragments 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_176700
Sequence length 311
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_611:65170-66105(+) | length=311
Sequence
MEAILNKIIFQCTAFKNKLPDYIRAQNITYIKDREDIPIAERIKVAEENLEHFNDYHAKG
EAVKGDLNDLRLDLDALMHELSEEVRKYEDKEGSYNTLIDTLVYLEQKKAQQEKQILQTQ
IDEIDSTFRVKEKSLETKKKQISINGTLDEEEVSKIKEWSGKNVTNVLFDSNVDDWGTSA
VFNRKVVGRKEVVVVVEDMKGNKFGGVIFKTIQAEDLNTADPQAFAFVLKTKGKIKGASK
FKILEAHTNYAFGCYKDDHPRLFYITNCIFVMKRGEEGSNCISGITEIPVKTNFCGGVNF
TPKRILVFQLH
Download sequence
Identical sequences L7FK97
jCVI|EIN_176700 XP_004185690.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]