SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_179180 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_179180
Domain Number 1 Region: 5-110
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000471
Family Myosin rod fragments 0.015
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_179180
Domain Number - Region: 88-164
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0175
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_179180
Sequence length 165
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_628:133717-134239(+) | length=165
Sequence
MTCNTLKQSKNTYEKELTELNEQLDLERTTAQQAKARKKKYADKLREVMENENEFGEYKE
HAEKSINSLTAQKADSQKQLEKERAMKQKPDKETQRLRAKVTDAEVKLADAGATGASIAK
LKAKYETELEGIETEKEEAQNAAAKAKKQAKQYARKVEEAERKLA
Download sequence
Identical sequences A0A0A1U9Z0
XP_004256732.1.21224 jCVI|EIN_179180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]