SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_192950 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_192950
Domain Number 1 Region: 36-151
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000994
Family Myosin rod fragments 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_192950
Sequence length 155
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_674:407046-407513(-) | length=155
Sequence
MLNARIAEIQTQPDEERQKAESADAVRKADSQKELEKERAMKQKPDKETQKLRAKVTNSE
AKLADAGATGASIAKLKAKYETELEGIETEKEEAQNAAAKAKKQVKQYARKVEEAERKLA
EFEQKESTINTQIGKTQADLKKTQQSVRDGETENR
Download sequence
Identical sequences A0A0A1TXT2
XP_004185510.1.21224 jCVI|EIN_192950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]