SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_193230 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_193230
Domain Number 1 Region: 411-540
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.8e-19
Family Synaptotagmin-like (S variant) 0.019
Further Details:      
 
Domain Number 2 Region: 356-394
Classification Level Classification E-value
Superfamily WW domain 0.000000000106
Family WW domain 0.0014
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_193230
Domain Number - Region: 5-124
Classification Level Classification E-value
Superfamily E set domains 0.000369
Family Arrestin/Vps26-like 0.013
Further Details:      
 
Domain Number - Region: 148-253
Classification Level Classification E-value
Superfamily E set domains 0.00201
Family Arrestin/Vps26-like 0.015
Further Details:      
 
Domain Number - Region: 313-344
Classification Level Classification E-value
Superfamily WW domain 0.0871
Family WW domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_193230
Sequence length 595
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_674:495860-497699(-) | length=595
Sequence
MKIDITLTHPGQVLGEQIRGFVTAKAILIYTRTVTTYSTVNKRRVAHHHTVTEHVNTKVY
QSPDFPVIEELHNHNISLTTELAPGKYDYPFVFQLPQGLPSSQFFTGRNVSVTYQISAKV
ISKNNSTTKSSGFVLPVCISTQRHIPRPKMFVDNTAPLSIQLAIDDEIPAVGDVVTGTLQ
LRNDSQHNVTMTASFCAVHTYRNTRCEVFSGTTAFPVFGPRSTNSAPFNMSVPIDIPLSI
SNDPFNVSNYIKIDGSYGGKSFQMLCPIQIGCDMIDPRMMCERAAVFGGRRDFTKATAFY
GKHFRVPPHYENITNPNLPIGVEEIEGVDGQNYFVSHFSRQCSFTPDMQNGCNIPYPSYN
SAMLPPGWAMGMDYGETYFIDHNTRSTTWVDPRPMEQRIVPHIALNKTATFTVEIIKATG
LPILGWGFPDPYACVWDEKQKWVSTGVVPKSIDPVFTKNNTLSFKVEKDRRNVMVYLYDK
HKITYDVFMGAINFDLQYFPPDVSIQDWFQLSCFGEKETAITGKVLMKVCYRVNEDVNNV
AVDIIGKSPLLQDYYPYTHFIMDQIEKQNKARTEKKLPENSMMMCEGKIICRNPI
Download sequence
Identical sequences A0A0A1U3N0
jCVI|EIN_193230 XP_004185537.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]