SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_193280 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_193280
Domain Number 1 Region: 61-821
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.59e-231
Family Motor proteins 0.0000000000275
Further Details:      
 
Domain Number 2 Region: 1099-1222
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000018
Family Myosin rod fragments 0.0015
Further Details:      
 
Domain Number 3 Region: 901-1014
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000392
Family Myosin rod fragments 0.0025
Further Details:      
 
Domain Number 4 Region: 1401-1505
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000497
Family Myosin rod fragments 0.0077
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_193280
Domain Number - Region: 1142-1401
Classification Level Classification E-value
Superfamily Tropomyosin 0.000621
Family Tropomyosin 0.0012
Further Details:      
 
Domain Number - Region: 1023-1136
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0022
Family Myosin rod fragments 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_193280
Sequence length 1590
Comment | organism=Entamoeba_invadens_IP1 | product=myosin-2 heavy chain, non muscle, putative | location=EINV_674:534486-539521(-) | length=1590
Sequence
MANAFGEGSNDDYLKYMIYKLPDDYRDQKLKLVPNGMEIETEYQEFLAAQIKSEQGDNYI
LETDAGEIKIAKKECYSRNPSKFDGVDDMSQLTQLSEATVLYNLRLRYMKDIIHTYSGLF
CVVINPYQFFPIYTHFMINKYTGRRKEEVAPHVYAIAEGALTQMRDLSAQFRNQSILITG
ESGAGKTENTKRVIQYIATIAGRSNAAMGDIENQLIQLNPMLEAFGNAKTVKNNNSSRFG
KFIEIQCQANXXVIGCKMTMYLLEKSRIVSQAKEDRNYHIFYQCWLNKTSPNEIMVDGMN
DLEEFKNTVAAMRTLGLSDNQQEEVFKIVAGMLHMGNVCYVDGKDLAEISNLDELSKACE
LWGCEPEALRKALIQPSFKTGKEVIEKKYNKTEAEASTQAMLKFIYHRLFVFIVEQVNRV
MRKDGDTSIGILDIAGFEIFRENSFEQLCINLTNEKLQQFFNNHMFNLEQEEYLREGIEW
TRQNFGNDLQPVIDLIESKQKASILSHLESQCFTNAGNDKQFYDLICQAFGGHPKFRKPR
VASTAGHFEFDIIHYAGDVTYDGIDWVRKNKDPLEPQIKETFLAAQGKFISELFSLHVAG
GDDSGASAGGANKGQRGAKFLTVGSNHREQLDDLMKKLRMTTPHFIRCILPNTQKRRHYF
IDSTVLKQLRCNGVLEGIRITRLGYPNRIIYNEFLKRYFFLGTNINKKTSDAMPVVKKLM
KQICEKYKKDGKPRVNTEEFRFGKTKIFFKVGVLAEIEEIRENRVTELICGLHMCAKAFA
QRKLIEQKRNEQIAINVIQDTIHTWYQFRNWVWFRLFQKVRPTLKRRRVDEELAAKDKEI
EALKKKLGEEIEKREAAEKALSEMKFKNVDLEALVQKLKDEIEELKEEIESKKITLEEAD
MKSQEDQEHIEELQGDIKRGKEDLSKLTTEYKKLEADNQGLQDEITEHKATIVKKDSVIT
ELNKDIEDKEGEISDLKKKLEAEEDNSKDLETQLHEKEDDIADLEKQVKKLQNTISDVNA
QNEDTGAVLNDTKDDLANTKNDLKKTQLALDDTEKKLDQQVAQNKKVSDERDGYNQQLQA
EKTKTAALTSAKNASDKKISSLNSEKDELEDKNRKLDSSNKDAQRKIAELTKRIEDGLND
SDMLKAQKADYEAQIQALKDDMEKTEKDLAGAKSNMNQKDVEINNLNEQLAEEQKEKEEL
EAKKKKAENDLADLEDAQSNLQSEKDKTEKDRKKLDNDLKEALQKLADITAELEKNKAAN
KELQAKLDETADNKDKLEADAENMNRKKDAQEKQLAQLKADNDNLTKTKSVVDAKLKDAE
REKAALNVKTELDQLQQNFNYLKKNADTDAADKKKLNGTVNESNKKIEELSAKVDELTGV
ITRREQEVAEANEELETVKKDKFAKEKEAKKLKAENDEIKEKVKNLANDKDQLSSEKKKL
QDEYDQLNNLVSGHEDETNKLNGSIRKLQRDLEANNTELTELRDRTAKDKKKIADLEQQV
QDLEDRPVGTSNIDQTEVIKRDNQIADLEKAVAALKDQNTQLDAAKKDMKKQSVEDASKI
ENYESQIKALEAQKKMALDDKAEAEKTAAD
Download sequence
Identical sequences jCVI|EIN_193280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]