SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_193740 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_193740
Domain Number - Region: 16-134
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.011
Family Myosin rod fragments 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_193740
Sequence length 176
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_675:19916-20589(+) | length=176
Sequence
MDLDDKADAENIAADQSDRRKNIEDQIKALNAKSLDESKLQEVQFNLDKTNNTKEKLIKK
VNELIVQVDQLTDEKKKDEKDLEKMDKMIKDSNAKVDKAQKQLDTTNDDKDGNEAMKQKY
QDELKSVRTELDQEKKDHSKTQLIKGKYEKDIAEIIVRAETLEKKSKWLNKRRLRL
Download sequence
Identical sequences L7FNS9
XP_004255527.1.21224 jCVI|EIN_193740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]