SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_195410 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_195410
Domain Number 1 Region: 18-124
Classification Level Classification E-value
Superfamily E set domains 0.0000000341
Family ML domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_195410
Sequence length 144
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_682:50501-50935(+) | length=144
Sequence
MMFLCVLIFATTYAQPGTIDVKQCPDIHYTPSILINKLEYDQYPYLDDTTYMFKINVTIP
TEKATMTWFLEYYWGTLYIASYGYEDVDLCGKVPMGCPLTIGEYGFSAEAKVKDVALAGW
YLLNIHFSTLIEEFGCYQGWIYLY
Download sequence
Identical sequences A0A0A1UB62
XP_004259197.1.21224 jCVI|EIN_195410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]