SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_195430 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_195430
Domain Number - Region: 18-137
Classification Level Classification E-value
Superfamily E set domains 0.000497
Family RhoGDI-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_195430
Sequence length 144
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_682:52950-53384(+) | length=144
Sequence
MFFIALLLAFCSADPGIIDMKFCPDKPVNLDIDIMKVEYQKPAERIRTNYTIYMEVIKPH
TDLVLKWHVEYYWGSLYISSYQYDDRDVCIAIEGGCPTKLGPNQMKEIGYIKESVTLPGW
YSLVLEMTDNNLYNSCFHGWVYLF
Download sequence
Identical sequences A0A0A1UG81
XP_004259199.1.21224 jCVI|EIN_195430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]