SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_197930 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_197930
Domain Number - Region: 140-205
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00759
Family Myosin rod fragments 0.0055
Further Details:      
 
Domain Number - Region: 11-124
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0994
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_197930
Sequence length 363
Comment | organism=Entamoeba_invadens_IP1 | product=meiosis-specific nuclear structural protein, putative | location=EINV_697:4401-5490(+) | length=363
Sequence
MSELNTQTTKTTEERAKEISDLIRRNKEWAEGKEQLVDKGKRLEEENTKLHEEVAAQTEK
IGKLENQLLTYEKNTQEAKEVSEALKKLQTEFERKTSEDETLKQEKEQLNAELKEVKTDN
SLFKEKNEVLEKQIAENTTELQKQREKNKKANETIEKLLKETTEQSSKYAFLMKEKCQLT
ISLEQMKTQMSQLVGDKQKLEEKMTTKDAEMQKMQDAVISASKNIEKLQTTILEKTQKIK
NLENIIEQQKVYEGQINELKQENKEKQMQIETINTKLAELHTKLESEKTKSLEVVKKIET
LQVENAKYVNEKKNDEIEMTRLQQEVQKNEVERIKKTEDNTKIVEKLEKKVFELTEEQKR
AQS
Download sequence
Identical sequences A0A0A1TV20
XP_004183505.1.21224 jCVI|EIN_197930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]