SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_199320 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_199320
Domain Number - Region: 6-92
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000392
Family Myosin rod fragments 0.0066
Further Details:      
 
Domain Number - Region: 178-288
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000889
Family Myosin rod fragments 0.0091
Further Details:      
 
Domain Number - Region: 304-360
Classification Level Classification E-value
Superfamily Tropomyosin 0.00654
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_199320
Sequence length 366
Comment | organism=Entamoeba_invadens_IP1 | product=M protein, serotype 6 precursor, putative | location=EINV_701:65843-67277(+) | length=366
Sequence
MKSQEDQKHIEELQGDIKRGKEDLSKLTTEYKLLEADNQRLQDEITEHKATIVKRDSKLV
AEEDNSKDLEKQLHEKEDDIAYLENEKQSVEDASKIENYESQIKALEAQKKMALDDKAEA
EKTAADQSDRRKKMEDQVKALNAQNSQEQILNSTRNKTICDKFENDMSEMKTELEALEQA
ANTFKQSKNTYEKKLTELNEQLGLEKKTVQQAKAQKKKYADKLREVMENENKFGEYKEQA
EKSINLLTAQKADLQKELEKERAMKQEADKETQRLRAKVTEVEAKLADAGAIGTSIAKLK
AKHETELEEAQDAAAKAKKQAKQYAKKVEKAERKLAKFERKESIFNTHIGKTQADLKMTR
HSVRDS
Download sequence
Identical sequences jCVI|EIN_199320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]