SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_199930 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_199930
Domain Number 1 Region: 101-158
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.09e-22
Family Chaperone J-domain 0.00048
Further Details:      
 
Domain Number 2 Region: 241-396
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.7e-19
Family Sec63 N-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 588-688
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000042
Family Sec63 C-terminal domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_199930
Sequence length 722
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_706:110883-113051(+) | length=722
Sequence
MSEEKPIFDDQMFQVFLTGLSGTIVVLWVLYLLRQRIKVLPSFPCTCSRCLEKKAKLTRR
RNRLTGSLCLQLFFIFLLTLLFLRGAYKTVTTPVGTPTVLYDPYTILEVSQTSSDKDIRS
SYRKLSLKYHPDKNKSPEAEEKFIQITKAYETLTDPLKLKLWRETGNEEEKRIEKNGIGL
PMFLTLQKNRTVVLGFYFFIVVILFPIGVWLLLRKFHNYDNNNLTLETNAIFMQLIDTNL
TFPTLIEVLTLSNEITEIVTIKPDDQKYLPAIQKRVNSLFIKTPKYNSPQAVKAQILLAA
HLTRLHNELPYYLRDDLDEILQVVPNILHGMVSVMFSKRNLNGVWQCIRLNQMVTQATDI
EFNQIPEDVDSKLFGKNMTFEKFCRLTPEDRKRLIEDRVVDGIDKSKDVKLIQPLKEKSE
VKKMKLETVKEKIKQSINEKDKKMGKKPRFEAVEEHCSIQSKEIKEKSDLALQDQSHKTD
TNAFKPLTVEAKTRQKVILNYFNYFPTTIDFVVRAMSATMTRTVIAGIPLVIVINAYRYP
RGQDGEVLPKLRGKLQKILDAEKEDLPVEPQSAEELLKRPTEEQEDDVDPVIPDVEIVHA
PPQDVYVHCPYCPNERLERWWFILTDMRNSVVLNAAHGYIPVSELPFITRVFAPTPKQAG
NYAVSLHIVCDSYMGCSRVFPLNFTVVERKKSAEEDLVNGEEEEEEMESDDVESSEDAKK
DK
Download sequence
Identical sequences A0A0A1UH53
jCVI|EIN_199930 XP_004261492.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]