SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_205730 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_205730
Domain Number 1 Region: 20-132
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000536
Family Tropomyosin 0.0046
Further Details:      
 
Domain Number 2 Region: 145-248
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000288
Family Myosin rod fragments 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_205730
Sequence length 343
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein, conserved | location=EINV_735:16885-18073(+) | length=343
Sequence
MLKAQKADYEAQIQVLKDDMEKTENDMAGAISNMNQKDKDKLEADAENMNRKKDAQEKQL
AQLKADNDNLTKAKSIVDAKLEDAEREKAALNEEVEAANEKLRITKNDLGRTKAELDQLQ
QNFDYFKKNADTDAADKKKLNGTDKFAKEKEAKKLKAENDEIKEKVKNLANDRYQLSSEK
KKLQDEYDQLNNSVFGHEDETNNLNGSIKKLQRDLETNNTELTELRDRTAKDKKKIADLE
QQVQDLEDRPVGTSNTDQTEVIKRDNQIADLEKAVAALKDQNTQLDAAKKDMKKQSVEDA
SKIENYEPQINALEAQKKMALDNKAEAEKTAADQSDRRKKKEY
Download sequence
Identical sequences A0A0A1U5R6
jCVI|EIN_205730 XP_004256424.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]