SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_228490 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_228490
Domain Number 1 Region: 40-160
Classification Level Classification E-value
Superfamily E set domains 0.000084
Family Arrestin/Vps26-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_228490
Sequence length 427
Comment | organism=Entamoeba_invadens_IP1 | product=vacuolar protein sorting-associated protein, putative | location=EINV_832:85451-86734(-) | length=427
Sequence
MNSKHSMSFLFSSPIQIDILLDNDHEKAKMTKVVNKQKVDIPIYMRNEDVSGKVMVTLKD
KKFEHQGIRIDFVGTIEYSYDRSSTSNFIQQTFELSRPTIMTEEKTMFPFNFSGIDKKYD
SYAGKNVRLRYYLRVTVNKKYSSGMNKEIDIWVVNYQDQPQKNEPILMDVGVEKSISIEF
KYRKSFYTLSDVVLGQVYFKTVRLPLASMELQILRKETTGYPPNQTVETETLARYELMDG
APVKGESMPIRVFLANLDLTPSYHNINNMFSVTYHLHLVLIEENSKRYFKQCEFKLWRKK
PDVQIVAQEVKTAANTDGLAGCQEAPYKGTDGQNVNKPLPHVNEAENVKEDVTPVEEKPQ
IIEEAKQTQPIAQDVKQEVPEETKQVENTEVKKEEKKEESKSDKKENKPIDISSFIQDDK
QEDENLF
Download sequence
Identical sequences A0A0A1UAG4
jCVI|EIN_228490 XP_004258783.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]