SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_233480 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_233480
Domain Number 1 Region: 393-503
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000732
Family Myosin rod fragments 0.0071
Further Details:      
 
Domain Number 2 Region: 44-267
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000314
Family Tropomyosin 0.0072
Further Details:      
 
Domain Number 3 Region: 270-389
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000392
Family Tropomyosin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_233480
Sequence length 718
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_867:34681-37555(+) | length=718
Sequence
MPVVKELMKQICEKYKKQAKSGTEEFKFGKIKIFFKVADNQRLQNGITEHKATIAKKDSV
ITEFNKNIENKEGEISDLKKKLEAEKDNSKDLETQLHEKENIIADLEKQVKKLQNTISDV
NAQNEDTGAVLNDTKDDLANTKNDLKKTQLALDNTEKKLDQQVAQNKKVSDERDGYNQQL
QAGKTKTAALTSAKNASDKKISALNSEKDELEDKNRKLDSSNKDAQRKIAELTKRIEDGL
NDSDMLKAQKADYEAQIQALKDDMEKTEKIWLLEFDAEDTNRKKDAQEKQLSQLKADNDN
LTKAKSVVDAKLEDAEREKAALNEEVEAANEKLRIAKTDLGRTKAELDQLQQNFDYFKKN
ADTDAADKKKLNKTVNESNKKIEELIAEANEEFETVKKDKFAKEKEAKKLKAENDEIKEK
VKNLANDKDQLSSEKKKLQDQYDQLINLVYGHEDETNNLNGSIKKLQRDLEANNTELTEL
RDRTAKDKKKIADLEQQVQDLKDRPVGTSNTDQTEVIKRDNQIVDLEKAVAALKDQNTQL
DAAKKDIKKQAVEDASKIGDYESQIKALEAQKKMALDDKTDDEKTAADQFNRRKNVEDQV
KVLNAQVSSLKVLVTNDLTFQVDQLTDEEKNEKDLEEMDKMVNDLDAEADKAQKQLDTAN
DDKDGNEVMKQKYQDELKSYKKDIAEIIVRAETLEKNIQMAEQEYVKTMRDYKTASEE
Download sequence
Identical sequences L7FM49
XP_004257016.1.21224 jCVI|EIN_233480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]