SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_238710 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_238710
Domain Number 1 Region: 73-857
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.42e-238
Family Motor proteins 0.0000000000151
Further Details:      
 
Domain Number 2 Region: 1124-1308
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000235
Family Tropomyosin 0.0066
Further Details:      
 
Domain Number 3 Region: 1307-1451
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000258
Family Tropomyosin 0.004
Further Details:      
 
Domain Number 4 Region: 1450-1560
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000392
Family Myosin rod fragments 0.0072
Further Details:      
 
Domain Number 5 Region: 933-1050
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000523
Family Myosin rod fragments 0.0026
Further Details:      
 
Domain Number 6 Region: 1946-2137
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000556
Family Tropomyosin 0.0016
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_238710
Domain Number - Region: 1572-1810
Classification Level Classification E-value
Superfamily Tropomyosin 0.000817
Family Tropomyosin 0.001
Further Details:      
 
Domain Number - Region: 1836-1951
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0225
Family Myosin rod fragments 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_238710
Sequence length 2141
Comment | organism=Entamoeba_invadens_IP1 | product=myosin-2 heavy chain, non muscle, putative | location=EINV_878:63798-70223(+) | length=2141
Sequence
MANAFGEGSNDDYLKYMIYKLPDDYRGVTTGWVWYNNPAPRPKIEIGANGMEIETEYQEF
LTAQIKSEQGDNYILDTDAGEIKIAKKECYSRNPTKFDGVDDMSQLTQLSEATVLYNLRL
RYMKDIIHTYSGLFCVVINPYQFFPIYTPFMINKYTGRRKEEVAPHVYAIAEGALTQMRD
LSAQFRNQSILITGESGAGKTENTKRVIQYIATIAGRSSATMGDIENQLIQLNPMLEAFG
NAKTVKNNNSSRFGKFIEIQFQANKVIGCKMTMYLLEKSRIVSQAKEDRNYHIFYQLLAG
ATPQQRSEWRLEAPDKYRLIYQNKTSPNEIMVDGMNDLEEFKNTVAAMRTLGLSDNQQEE
VFKIVAGMLHMGNVCYVDGKDMAEISNLDELSKACELWGCEPEALRKALIQPSFKTGKEV
IEKKYNKTEAEASTQAMLKFIYHRLFVFIVEQVNRVMRKDGDTSIGILDIAGFEIFRENS
FEQLCINLTNEKLQQFFNNHMFNLEQEEYLREGIEWTRQNFGNDLQPVIDLIESKQKASI
LSHLESQCFTNAGNDKQFYDLICQAFGGHPKFRKPRVASTAGHFEFDIIHYAGDVTYDGI
DWVRKNKDPLEPQIKETFLAAQGKFISELFSLHVAGGDDSGVSAGGANKGQRGAKFLTVG
SNHREQLDDLMKKLRMTTPHFIRCILPNTQKRRHYFIDSTVLKQLRCNGVLEGIRITRLG
YPNRIIYNEFLKRYFFLGTNINKKTSDAMPVVKELMKQICEKYKKDGKPRVNTEEFRFGK
TKIFFKVGVLAEIEEIRENRVTELIGGLHMCAKAFAQRKLIEQKRNEQIAITVIQDTIHT
WYQFRNWVWFRLFQKVRPTLKRRRVDEELAAKDKEIEALKKKLAEEIKKREAAEKALSEM
KIKNVDLEALVQKLKDEIEELKEEIESKKIALEEADMKSQEDQEHIEELQGDIKRGKEDL
SKLTTEYKKLEADNQGLQDEIIEHKATIAKKDSVITELNKDIEDREGEISDLKKKLEAEE
DNSKDLETQLHEKEDDIADLEKQVKKLQNTISDVNAQNEDTGAVLNDTKDDLSNTKNELK
KTQLALDDTEKKLDQQVAQNKKVSDERDGYNQQLQAEKTKTAALTSAKNASDKKISALNS
DKDELEDKNRKLDSMNKDAQRKIAELTKRIEDGLNDSDMLKAQKADYESQIQALKDDMEK
TEKDLAGAKSNMNQKDVEINNLNERLAETEKEKEEIEAKKKKAENELADLEDAQSNLQSE
KDRTEKEKKKLDNDLKEALQKLADITAELEKNKAANKELQAKLDETADNKDKLEADAENM
NRKKDAQEKQLAQLKADNDNISKAKSIVDAKLKDAEREKAALNEEVEAVSEKLRITKNDL
GRTKAELDQLQQNYDYLKKNADTDAADKKKLNGTVNESNKKIEELSAKVDELTGVITRRE
QEVAEANEELETVKKDKFAKEKEAKKLKAENDEIKEKVKNLANDKDQLSSEKKKLQDEYD
QLNNLVSAHEDETNSLNGTIKKLQRDVEANNLELNELRDRTAKDKKKIADLEQQVQDLED
RPVGTSNIDQTEVIKRDNQIADLEKAVAALKEQNTQLDAAKKDMKKQSVEDASKIENYES
QIKALEAQKKMALDDKAEAEKTAADQSDRRKKMEDQVKALNAQVSSLKVQVSAPASVAQE
EEKNMLNARIAEIQAQLDEERQKADSADAARKAAESKLQEVQFNLDEANNTKEKLTKKAN
DLTVQVDQLTEEKKKNEKDLEEMDKMINDLNAEVDKAQKQLDTANDDKDGNEAMKQKYQD
ELKNVRTELDQEKKDHAKTQLIKGKYEKEIAEITVRAETLEKNVQMAEQEKVKTMRDYKA
ASEELMRTKTELDEKQDECDKLEDDLSEMKTELEALEQAAKTYKQSKNTYEKKLTELNEQ
LDLERTTAQQAKAQKKKYAEKLREVMENENEFGEYKEQAEKSINSLTAQKADLQKELEKE
RSLKQEADKETQRLRAKVTDAEAKLADAGATGASIAKLKAKYNQELESVEQEKEEAQNAA
AKAKKQAKQYARKVEEAERKLAEYEQKESTFNTQIGKTQADLKKTQQSVRDSEMRIAELE
DQVRKANEDLNNKQLEVDKVNAELKKTKNRLKKMQKDDSDD
Download sequence
Identical sequences A0A0A1UA28
jCVI|EIN_238710 XP_004256777.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]