SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_243410 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_243410
Domain Number 1 Region: 242-505
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-77
Family Protein kinases, catalytic subunit 0.0000578
Further Details:      
 
Domain Number 2 Region: 21-77
Classification Level Classification E-value
Superfamily E set domains 0.00007
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_243410
Sequence length 519
Comment | organism=Entamoeba_invadens_IP1 | product=serine/threonine protein kinase-transforming protein Rmil, putative | location=EINV_881:110459-112018(-) | length=519
Sequence
MFLLCVSLISCVSYSQTTHPKIVSVYPEAVPCVGSHKVSITTEDTIDTSTQLSCYFNENE
MPFISSDDTHGTCYSPDFSGMLEPPVFVEYLLIDSKGKPPKQNITKKMTFYNVTLRSGVQ
STFKKNQVLFLQGEGFIEDKNSQCILKQHNTTFMVKGLFSTPTVFICYIEDILGKLVGQT
MNITLNLNGQDESLSVLEYQFTEFSESTHILAFIVISLSILFVVVLLTLLAVFILKNILK
KKTDVLQDLINPGEVLCEEVIGSGSFGDVWRAKWRGENIAVKLIPTRSMVKSDVLECVKE
IQLMRRLTHPNVLQFFGCGTDENYILIAMALMERGSVHQMLSDKSFYLSWPRRLQMLHDV
AMGMNYLHTQTPPIIHRDLKSHNLLVDQNWSVKVSDFGLSVTTGEMIKTTICGTLAWIAP
EILSGQPYNTKVDVYSFGIVMWEFLTRDVPYKNVPPQSLPNYVTQVGLRPKLAGEVDNDY
LELMTLCWKKQPVFRPDFAEVCQLLSALIAKKVDITPLN
Download sequence
Identical sequences A0A0A1U153
jCVI|EIN_243410 XP_004254548.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]