SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_248390 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_248390
Domain Number 1 Region: 70-176
Classification Level Classification E-value
Superfamily E set domains 7.34e-25
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 406-535
Classification Level Classification E-value
Superfamily E set domains 2.14e-19
Family Filamin repeat (rod domain) 0.0021
Further Details:      
 
Domain Number 3 Region: 326-440
Classification Level Classification E-value
Superfamily E set domains 2.07e-17
Family Filamin repeat (rod domain) 0.005
Further Details:      
 
Domain Number 4 Region: 163-247
Classification Level Classification E-value
Superfamily E set domains 1.53e-16
Family Filamin repeat (rod domain) 0.0015
Further Details:      
 
Domain Number 5 Region: 544-624
Classification Level Classification E-value
Superfamily E set domains 0.0000000000042
Family Filamin repeat (rod domain) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_248390
Sequence length 624
Comment | organism=Entamoeba_invadens_IP1 | product=actin binding protein, putative | location=EINV_900:28924-30798(+) | length=624
Sequence
MAEEPQNPPTADTAPAVNPDEPPDFNIESDADVEPFVVQLKAFLEKHDMDVKVKLRPKKI
RGSTSSVDGDGLKTGEVNIPADFKITGRDNNGKEVDHGGDKVEVKVVDPQGNEVPCEVVD
NNDGTYDVKYTPVVPGDHKIEVKVNDEVVEKTPVDVLVFDELADALNCTAEGPGLNEAET
KTPAPFKIITRNRIGQPLKKGGQKFDVTVNGPTIPADVQVKDNEDGTYDVEYVAKEPGKT
HIDVKVDAPVKAEGEKKPEGAEGAENAAPAEQEKKLEEDGTAPAEGEKKEGEPKKEMQSI
KNMPVDLDVKLNHDDADPKQCWADGPGVEGGCKTCDLAKFVIHAIKPNGEPCALDKVPFD
VCVTDPEDEEIEAKIEKAEDGTYNAEYMPTKPGKYNVEVIIRNPEVPSNFEHIKGSPYTP
EILAGISGKNCVVSGPGVDGGEELDDCNDAEFTIQAKDFNGDDIKEGGAEFDVKVHDPNG
DDLPCEVKDNGDGTYGCKYAPEFPGDYKIDIDIKNDTHEKVGKAPYEVCVGEGVDNNKTG
VDCFQFTIIAKSKRGGPVKPGHAKFAVKITHESGTEIPQENIDIKNLKEAKYRVTYKIGE
HGAYTIHCTLNNRDIKGSPWVQNC
Download sequence
Identical sequences A0A0A1TUE3
jCVI|EIN_248390 XP_004182964.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]