SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_252620 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_252620
Domain Number 1 Region: 246-451
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000654
Family Tropomyosin 0.0017
Further Details:      
 
Domain Number 2 Region: 412-611
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000785
Family Tropomyosin 0.0039
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_252620
Domain Number - Region: 1049-1146
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0863
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_252620
Sequence length 1313
Comment | organism=Entamoeba_invadens_IP1 | product=myosin-2 heavy chain, non muscle, putative | location=EINV_908:22999-26940(-) | length=1313
Sequence
MDKTEALKVIRNTLLQYSEKDNPWVRLFEQCKTDLAAAETAKTLENTQAAKGDLESQIKA
LTLENARLKEDIDNKFKQIKKYKDINYDLEQKAKDLEEKKLMADTLTQQAQLDLETEKET
NKNIKEDVLYNKQRNELLQQENKRISESLNEQTQKAEKAIITQKAAEKSKLDAETALLDL
QKTFEAANNELITFKAKSTQVESLVLEQENEIAELQNKVKDKEKVISGLNMDLDEYGKDL
DMEVANHKATQKKLEDQKLDNEDLRGQIEKLKETVDKLKNAGNDVQRLADQNNMSKNAAE
RRLVDIQKNLENTKEDLDKTEVELADTKKKLKDAIKEKEDLEQNYSSGNSILENIKESKV
KIEQEVVDLNNQLDEQRKKTVEAEGNFKRSEATIVALQTDLSDARHDIDGLNIQIKSLQN
EIASKEEDTEHCLNDLNAEKSLTKRLNAQIEDLKDDAAKGAEREQKLKDENKTLSDELEM
NKEKLNQIDITVSNGERRTKTLETQISNLNDTIERQKKEYAVLTKKYNDLTVDFKDKENE
AETSFEKIRALNSTIGQNERQIVDLKDTVSKLTPDLQAAKDNIKALQKQNKDLLEKNDDL
QHEVNTLNEKQKQFMEGHISMDELNDFENQIARKLKEKQTQFDDMVDKLTSALDDKEKQN
DKLEGRITELNKEREVRIDEIEKAQRERADFEQKAKLAKIESDAKAEMLERALKDRDALK
AQIRENEEHIETLSAGNVDASKVVEAAVASYKTQVSDLNMAINSLKEENERMKENMDSFR
LDASDLKVLLDDKDRELKSLQLKYVALTDELKHREDVIADMRLKKKQDTDEKAEMEMKMK
LMGSQMNVPQREMEQKIFDAELKTKSVLGDLEIVNQQLADMTEKKKTLEKEVESASEKYE
RLDKNYKELERTYKENFEEKTQYKNKMAEMEIEIEAKKETIEEMQEKYDDLKNEKEYNEA
TQQSNEKVGDEFTAKMMELNKKMLETNKMYKDTKSELIKVKSDLEDVEKELEETKTELVS
KDNELKKALSSNDELQYKVKFTNEACGSDQSAYQKMEEELDDLNNDYDELQDQCDILTQS
NDTLKKKNMELTEMYDSLMDENKKNKRIIEKNKFALEDKADKSEDEDDSYQRMKDQYDDL
KKKTDETIKQLNQQNDELKRKIEDMEIKMTALNATQNNGGDDVGKLKQQIAALQEAYDND
KQDLTAKAARFKKNASKYKEALAQAEEQKQKLSDDLAKAKAGGGSSAETKDLKSRIRDLQ
SEKETLEEKVSAANDATLQAKRDGQDAQDKLEQLQAKYKKLRKQFEALRDADD
Download sequence
Identical sequences A0A0A1U970
XP_004256512.1.21224 jCVI|EIN_252620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]