SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_259940 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_259940
Domain Number 1 Region: 75-157
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000445
Family Myosin rod fragments 0.0083
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_259940
Domain Number - Region: 4-54
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.029
Family Inorganic pyrophosphatase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_259940
Sequence length 160
Comment | organism=Entamoeba_invadens_IP1 | product=myosin heavy chain, skeletal muscle or cardiac muscle, putative | location=EINV_934:26095-26997(+) | length=160
Sequence
MPVVKDLMKLFCEKYKKQAKSEHWQIQLIEQKLDEHIAITVIQDTIHTWYQFRNWVWFRL
FQKVRPTLKRRRVDESDNQRLQDEITEHRATIAKKDSVITELNKNIEDKEGKISDLKKKH
EAKEDNSKDLETQLHEKEDNIADLEKQVKMLQNTISDVNA
Download sequence
Identical sequences A0A0A1U3N8
XP_004255541.1.21224 jCVI|EIN_259940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]