SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_262400 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_262400
Domain Number 1 Region: 7-143
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000567
Family Tropomyosin 0.0042
Further Details:      
 
Domain Number 2 Region: 147-256
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000759
Family Myosin rod fragments 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_262400
Sequence length 371
Comment | organism=Entamoeba_invadens_IP1 | product=M protein, serotype 5 precursor, putative | location=EINV_946:112238-113439(-) | length=371
Sequence
MEKTEKIWLLEADAENTNRKKDAREKQLSQLNADNDNLTKAKSVVDAKLEDAEREKAALN
EEVEAVIEKLRITKNDLGRTKTELDQLQQNIDYLKKYADTDAADKKKLNGTVNESNKKIE
ELSAKVDELSDVITRREQEVAEANEELETVKKDKFAKEKEAKKLKAENDEIKENMKKLAN
DKDQLSSEKKKLQYKYDHINNLVSGHEDETNNLNNSIRKLQRDLEANNTELNELKHRKAK
DKKKITDLEQQLQDLEYRPVGTSNIDQTEVIKRDNQIADLEKAVLALKEQNTQLDAAKKD
MKKQSVEDASNIENYKSQIKALEALNKMVWDDKTDDEKTAANQSDRKKKMEDQIKALNAQ
VLLLKVIVLIV
Download sequence
Identical sequences A0A0A1UEN2
XP_004259152.1.21224 jCVI|EIN_262400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]