SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_262410 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_262410
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00000288
Family HBL-like 0.022
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_262410
Domain Number - Region: 65-141
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000366
Family Myosin rod fragments 0.02
Further Details:      
 
Domain Number - Region: 131-197
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0126
Family Myosin rod fragments 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_262410
Sequence length 215
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein, conserved | location=EINV_946:113461-114208(-) | length=215
Sequence
MKSQEDQEHIEELQGDVKRGKEDLSKLTTEYKKFEADNQKLQDRITEHKATVAKKDSVIT
ELNKNIENKEGEISDLKKKLVAEEDNSKDLETQLHVNEDDIADLEKQVKILQNTISDVNA
QNEDSGAKVSDERDGYNQQLQAGKTKTAALTSAKNANDKKISALNSEKDELEDKNRKLDS
SNKDAQRKIAELTKRIENELNDSDMLKAQKADYEA
Download sequence
Identical sequences A0A0A1UB34
XP_004259153.1.21224 jCVI|EIN_262410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]