SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_262510 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_262510
Domain Number 1 Region: 137-231
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000233
Family Myosin rod fragments 0.0069
Further Details:      
 
Domain Number 2 Region: 13-189
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000392
Family Tropomyosin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_262510
Sequence length 274
Comment | organism=Entamoeba_invadens_IP1 | product=myosin heavy chain, clone, putative | location=EINV_946:143497-144407(+) | length=274
Sequence
MNNLPKLLITKTSLRLQLAQLNADNDNLTKAKSVVDAKLEDAEREKAALNEEVEAVIEKL
RITKNDLGRTKTELDQLQQNIDYLKKYADTDAADKKKLNGTVNESNKKIEELSAKVDELS
DVITRREQEVAEANEELETVKKDKFAKEKEAKKLKAENDEIKENMKKLANDKDQLSSEKK
KLQDEYDQLNDLVSGHEDETNNLNVDELRDKTAKDKKKIAHLEQKLQDLEYRPVGTSNID
QTEVNKRDNQIADLEKAVAALKDQNTQLDAAFKI
Download sequence
Identical sequences A0A0A1UEN7
jCVI|EIN_262510 XP_004259157.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]