SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_267900 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_267900
Domain Number - Region: 202-295
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0126
Family Myosin rod fragments 0.017
Further Details:      
 
Domain Number - Region: 368-554
Classification Level Classification E-value
Superfamily Tropomyosin 0.0248
Family Tropomyosin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_267900
Sequence length 559
Comment | organism=Entamoeba_invadens_IP1 | product=paramyosin, long form, putative | location=EINV_971:76865-79153(+) | length=559
Sequence
MIVTDGINELSASGHFLLVSIFEVTANGVTSDAMPVVKELMKQICEKDGKSYTEEFQISL
LNSEKDELEDKNRKLAELVKKIEDGLIDSDMLKAQKADYKAQIQALKDDMEKTGKDLAVV
DAKLKDAEREKVALNEEVEAAIEKLRIAKNDLGRTKAELDQLQQNFDYLKKNADTDAADK
KKLNETVNENNKKLEELINEELETVKKDKFVKEIEAKKLKTENEEIKENMKNLAYDKDQL
SSEKKKLQDEYDQLINLVSAHEDETNNLNGSIKKDRTVKDKKKIADLEQQVQDLEYRPVG
TSNIDQTEVIKRDNQIADLEKAVAALKDQNTQLDAAKKDMKKQSVEDALNIENNESHIKA
LEAQKKMALDNKAEAEKTAADQSDRRWKTNAPASVAQEEEKNMLNARIAGIQAQPDEERQ
KLDSADAARKAAESKLQEVQFNLDEANNTKEKLTKKANDLTDLEEKDKMINDLNAEVDKA
QKQLDTANDDKDGNEAMKQKYQDELMSVRTELDQEKKDHTKTQLIKGKYEKDIAEIIVRA
KTFEKKVQMAEQSQDYEKL
Download sequence
Identical sequences A0A0A1U9J9
jCVI|EIN_267900 XP_004258303.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]