SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_267910 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_267910
Domain Number 1 Region: 2-111
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000732
Family Myosin rod fragments 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_267910
Sequence length 127
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_971:79513-79896(+) | length=127
Sequence
MKQEADKETQRLRAKVTDAEAKLADSGATGASIAKLKAKYETELEGIETEKEEAQNAAAK
AKKQAKQYARKVEEAERKLAEFEQKESTFNTQIGKTQADLKKTQQSVRDGELRIVELEDR
SERLVKI
Download sequence
Identical sequences A0A0A1UCY0
XP_004258304.1.21224 jCVI|EIN_267910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]