SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_274360 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_274360
Domain Number 1 Region: 56-150
Classification Level Classification E-value
Superfamily E set domains 1.4e-23
Family Filamin repeat (rod domain) 0.0015
Further Details:      
 
Domain Number 2 Region: 282-394
Classification Level Classification E-value
Superfamily E set domains 4.27e-19
Family Filamin repeat (rod domain) 0.00094
Further Details:      
 
Domain Number 3 Region: 154-237
Classification Level Classification E-value
Superfamily E set domains 8.67e-17
Family Filamin repeat (rod domain) 0.0019
Further Details:      
 
Domain Number 4 Region: 416-520
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000934
Family Filamin repeat (rod domain) 0.0029
Further Details:      
 
Domain Number 5 Region: 721-801
Classification Level Classification E-value
Superfamily E set domains 0.00000000000167
Family Filamin repeat (rod domain) 0.0027
Further Details:      
 
Domain Number 6 Region: 508-554,658-707
Classification Level Classification E-value
Superfamily E set domains 0.000000000179
Family Filamin repeat (rod domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_274360
Sequence length 802
Comment | organism=Entamoeba_invadens_IP1 | product=actin binding protein, putative | location=EINV_998:43865-46273(+) | length=802
Sequence
MTEQPQQVNPDEPPNFNIESDADVEPLVTQLKVFLEKHDMNCSVKLRPKKMRGATSTVDG
DGIKTGEVNIPSDFTITGRDNNGKEVKHGGDAVKVKIVDPQGNEVTCEVVDKDDGTYEVK
YTPLVPGIHKVEVQVNDEQVENTPIDVYVYDEIPDALNCTADGEGLKTAETKTPAPFKIT
ARNRINEPLKKGGLVFDVKVTGPTTPADVQVIDNNDGTYDVNYTAKEVGDHHIDVLVKLP
EDRPKEEAQQDDKKTDDQQSQNENLKRIKEMPVDVKVELNKNSADPTKSYAEGPGVNGGA
NSRDPAEFTIHPIKSNGEPCDPAENTNFDVCVTDPDDNEIEAKVTKNEDGTYHAEYQPTK
PGEYQVEVMLRNPDVPTNFDHIKDSPFTCKILQDPSTACLLNSYAYGPGVDGKIGIDKIP
VFRIQAVTLSGVKCTKGGDEFKVEVKNPEGEVQTPKVNDKKNGTYDVKYKAKKPGFYEVK
ITLKDPEHPEEFKDIKGSVYRPEILNGVEPKNCIVEGQGITEPNDEDDNIFTIQAMDFDN
KKVEHGDTPFQVTIDQISIITDEKKDGEKEKEDTDDEKDNEEEVNDEDDGADEMFAMLQD
TVNPSNENEDQKTIEGTPEQSKQEESQQEETKEEQPKQDEKAQEESKEPEIEGKKIRQRK
QGNLPCTVVDKENGTYDVHYKAEAGKIRVKITLNNDKVAKSPYYLEVEEDADADESGVEN
FCFVVEAKNRRGQIQKDGKAKFTVDLDGPEGKLEEQKIKIKHLGEGKYFISYTLPAVKGD
YNVNCKLNRRHIANSPFKQSVN
Download sequence
Identical sequences A0A0A1U689
XP_004256648.1.21224 jCVI|EIN_274360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]