SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_295910 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_295910
Domain Number 1 Region: 558-744
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.69e-36
Family Actin/HSP70 0.00025
Further Details:      
 
Domain Number 2 Region: 427-563
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.68e-17
Family Actin/HSP70 0.00088
Further Details:      
 
Domain Number 3 Region: 292-384
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000107
Family Filamin repeat (rod domain) 0.0024
Further Details:      
 
Domain Number 4 Region: 199-278
Classification Level Classification E-value
Superfamily E set domains 0.00000000004
Family Filamin repeat (rod domain) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_295910
Sequence length 765
Comment | organism=Entamoeba_invadens_IP1 | product=actin-1, putative | location=EINV_1068:175870-178167(-) | length=765
Sequence
MSFFGKPKFSGNEFMVRCQCAQRRIDAQKRKYVTNSRSLKKQILTFLENNEREKAYDKCA
ILVQEDYKCEALEELVDIIDELQKNSEVIASQRICPLELKAACGAILYASPYFPDHTEMM
EMRNMLIDKFGKTFPEDCVNSKVVSAKLMSRLSSRNIDSDVIEYYLDNIAKENNLQTTTA
AVPTQNPEDALPADASRCELSKLPEGTQYVKYVFGVLTRNSTGNIRKGGDKVQVFIAGPN
NAKIVGDVKDLHDGTYDLSFDPPYEGDYLIAVYINDKQMNQVGKLHIKEGSMVDLNQCLV
EGNGLNGGYVNEKQFFTVFAKDQNGRTVGKGGEPFVAYVAGPGDVRIVADKTDLMNGQYD
FCYIPPVVGNYAIAIYHNQTQVKNVFQLEIKNKETFKPQFVSTPEVVHQPQEVKSVGVRV
GKPGEHFIIDVGSCIIKAGFESAGNPTLLTANVVGENLHKANMLGTPPIYVGDDAIGKRG
ILTLTYPMQKDPVDFEKLGRVLQYTMERAKGHPVVVVMNPLAPLQMKINMCEMLFKEEAE
SVRFVDEALAVSAYYKKPSCIVVDIGGMMSWAIPVVNGVVYKEISEKMPIAGVKCTEVFA
TLLTKEGVNLGSTSSEKVISRQIKECVGYIANDGAPAPSLKYDMPDGTLINVGNSRTQCF
EPLFNPQLCSMSCNGLSQMVEKVLRSINGTTNEVVLVGGGAMIKGIKERIEGDIMKALNF
KINVTADKNAKYAMWMGAGMLDKQNAGTLITAQVWKNEGALCLDD
Download sequence
Identical sequences A0A0A1UDM0
XP_004261427.1.21224 jCVI|EIN_295910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]