SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_310070 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_310070
Domain Number 1 Region: 257-380
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000314
Family Myosin rod fragments 0.0017
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_310070
Domain Number - Region: 186-294
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000209
Family Myosin rod fragments 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_310070
Sequence length 384
Comment | organism=Entamoeba_invadens_IP1 | product=myosin heavy chain, embryonic smooth muscle isoform, putative | location=EINV_1127:256749-258104(+) | length=384
Sequence
MCAKAFAQRKLIEQKRNERLPLLSFKTPSTLGTNSEIGRVDEELATKDKEIEALKKKLAE
EIAKREAAEKALAEMKIKNVDLEALVQKLKDEIEKLKEDIESKKIALDEADMKSREDQEQ
FEELQCDIKRGKEDLSKRSLKPKKTIQRISRHNCTKRKTTLLIWSVKNLQNTIADVNAQK
EDSGAVLNDTKDDLANTKNDLKKTQLALDNTEKKLDQQVAQNKKVSDERDGYNQQLQAAK
TKTAALTSAKNASDKKISTLNSEKDELEDKNRKLDSSNKDAQRKLAELTKRIEDGLNDSD
MLKAQKANYKAQIQALKDDMEKTENNLAGAKSNMNQKDVEINNLNEQLAEEQKEKEELEA
KKKKAENDLTDLEDAQSNLQSDKD
Download sequence
Identical sequences A0A0A1U9Y2
XP_004258520.1.21224 jCVI|EIN_310070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]