SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_037840 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_037840
Domain Number 1 Region: 8-229
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.68e-51
Family Calponin-homology domain, CH-domain 0.00039
Further Details:      
 
Domain Number 2 Region: 483-642
Classification Level Classification E-value
Superfamily EF-hand 2.65e-26
Family Penta-EF-hand proteins 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_037840
Sequence length 668
Comment | organism=Entamoeba_invadens_IP1 | product=grainin, putative | location=EINV_137:972314-974320(+) | length=668
Sequence
MSDAAAITEWEQSQIRTYTHWVNYNLDEKHQITDITKELGDSDVLISLIEKLAGKTFYSH
KPAVAKSKIFKINNCTKAIEVMHKEGVNADISAENIVDGEQKYILGMVWMMILKYKINNV
PKSDESSGKQAAAPVDAALLDWVNSLSDVKVTNFSSDWSSGEAFVALTGAVSFGEIDVNE
FDGLSPHDKIEKCQQAAQEKLNIPVLMDVQDLACEKPDPKSVMTYISVYKEKYPALQQAH
EDKIKQQQENEEAEKKRLADEEEERKEAERFAAEQAEKARIAAEEAERKRIAEEEAEKAR
IAAEEAEKARLAAEEAERLRKEKEEAERLAAEEAERARIQAEEAEKARLAAEELERQRQA
AQEESERQRIAAEQAEQARIAAEQAEKARIAAEEAEKARLAAEEAEKQRIAAEQAERDRI
AAQEAERQRMIAEEQERQRLAAIEAERLARERSSRPQFFAIQEAVDQWVAETVKAAVAAN
PRLQFQWWFPLVLTLTGNDYRELQAWFKKIDKDKSGTLELDELLKAKWPKDMKINSETTK
RLMMIFDAGCTGSIGFFEFVALYNWVKLCFATFNRFDKDNSDSLSLDEAQEALPYLGFSL
NKKNTNTLIKLNKNLFGKKKLNKVQFCCAVSYLAQCRTIYQLTFDTPAVDLDKVEFDKFV
NLVLSLAD
Download sequence
Identical sequences jCVI|EIN_037840 XP_004260234.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]