SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_044620 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_044620
Domain Number 1 Region: 250-352
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000235
Family Myosin rod fragments 0.008
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_044620
Domain Number - Region: 46-234
Classification Level Classification E-value
Superfamily Tropomyosin 0.000258
Family Tropomyosin 0.0055
Further Details:      
 
Domain Number - Region: 8-48
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.023
Family Motor proteins 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_044620
Sequence length 352
Comment | organism=Entamoeba_invadens_IP1 | product=myosin heavy chain, clone, putative | location=EINV_166:36100-37307(-) | length=352
Sequence
MPVVKKLMKQICEKYNKQAKSGTEEFKFGKIKIFFKVGVLAEIEERRRVDEELQPRTKKL
KPSRRNLLKKLQNEKREVAEKALSEMKIKNVDLETLKLEADNQRLQNDITEHKATIAKKD
SVITELNKDIEDNEGEISDLKKKLEAEEDNSKDFETQLHVKEDDIADLEKQVKKLQNTIS
DVNAQNEDTGAVLNDTKDDIANTKNDLKKTQLALDDTEKKLDQQVAQNKKVSDERNGYNQ
KLKAGKTKTAALTSAKNASDKKISALNSEKDELEDKNRKFDSSNKDAQRKIAKLTKRIED
GLNDSDMLKAQKADYEAQIQALKDDMEKTEKYLAVAKSNMNQNDVEINNLNE
Download sequence
Identical sequences L7FJ56
jCVI|EIN_044620 XP_004183140.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]