SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_098730 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_098730
Domain Number 1 Region: 39-148
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000837
Family Myosin rod fragments 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_098730
Sequence length 164
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_354:15798-16292(+) | length=164
Sequence
MENENEFGEYKEQAEKSINSLTAQKADLQKELEKERAMKQEADKETQKLRAKVTDSEAKL
ADASATGASFAKLKAKYETELEGIETEKEEAQNAADKAKKQAKQYARNVEEAERKLAEFE
QKESTFNTQIGKTQADMKKTQQSVRDGQLRIVELEDISENLVKI
Download sequence
Identical sequences A0A0A1U4B3
jCVI|EIN_098730 XP_004185881.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]