SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_121880 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_121880
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000974
Family Motor proteins 0.00066
Further Details:      
 
Domain Number 2 Region: 72-177
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000314
Family Myosin rod fragments 0.006
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_121880
Domain Number - Region: 357-464
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000392
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_121880
Sequence length 650
Comment | organism=Entamoeba_invadens_IP1 | product=myosin-7, putative | location=EINV_407:60678-63849(-) | length=650
Sequence
MKKLRMTTPHYIICQLRCNGVLEGIRITRLGYPNRIIYNEFLKRYFFLGTNINKKTSDAM
PVVKDLMKLFCEKYKKQAKSEHWQIQRGKEDLSKLTTEYKKLEADNQRLQDEITEHRATI
AKRDSVITELNKDIEGMESEISDLKKQFVAEEDNSKDLETQLHEKEDDIANLEKQTKTAA
LTLAKNANDKKISLLNSEKDELEDKNRKLAVLFKKIEDGLNDSDMLKAQKADYEAQIQAL
KDDMEKTKKDLAAKSVVDAKLKDTEKEKVSLNEEVEAANEKLRITKNDLGRTKPNLTNSN
RTYLKKNAATDAADKKKLNGTVNESNKKIEELSAKADKLSGVITRRGQEVAEADEELETV
KKDKFAKEIEAKKLKAENDEIKEEVKNLANDKDQLSSEKKKLQDEYDQLNNLVSGHEDEI
NNLNGSIKKLQRDLEANNTELTELRDRTAKDKKKITDLEQQRDNQIVDLEKAVAALKDQN
TQLDVVEKDMKKQSVEDASNIENNESHIKALEAQKKMALDDKAEAEKTAADQSDRRWKTK
SNTQCTTNNTEEKLTKKAKDLTVQVDQLIDEKKKNDNDLEEMDKMIKDLNAEVDIAQKQL
DTANDEKDGNEAMKQKYQDELKSVRTELDQENKDHTKTQLIKKIVQERYR
Download sequence
Identical sequences A0A0A1TVJ0
jCVI|EIN_121880 XP_004183766.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]