SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_165800 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_165800
Domain Number 1 Region: 5-222
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.16e-61
Family Calponin-homology domain, CH-domain 0.00023
Further Details:      
 
Domain Number 2 Region: 240-338
Classification Level Classification E-value
Superfamily E set domains 1.47e-21
Family Filamin repeat (rod domain) 0.0025
Further Details:      
 
Domain Number 3 Region: 342-442
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000173
Family Filamin repeat (rod domain) 0.0028
Further Details:      
 
Domain Number 4 Region: 461-571
Classification Level Classification E-value
Superfamily E set domains 0.000000000000193
Family Filamin repeat (rod domain) 0.0035
Further Details:      
 
Domain Number 5 Region: 736-816
Classification Level Classification E-value
Superfamily E set domains 0.000000000000701
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 6 Region: 558-604,674-722
Classification Level Classification E-value
Superfamily E set domains 0.00000000000187
Family Filamin repeat (rod domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_165800
Sequence length 817
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_553:97763-100216(-) | length=817
Sequence
MAEKQPQWVMTQKKTFTKWANVQLAGTYVINDVEKDLSDGIILISLFEALTKKKVSFKFN
KQPKMKIAKLENLEQALKFIVADGIKLVNIDAQNIFEGDLKLILGLLWVLILKYQIAANK
MDASTQALLDWVNSKIAPKKITNFKSDWNTGDTLNELIKALEPEFIDMGESENKETGAER
IKYGQQIAEDKMNIPAIIDAADMALPEPDDLSVMAYVSYFRHYEAEKEKMLNDMMMKKTP
DTEKCIIEGEGIKTGEVLVPDTFKVIAVNKMGNNITEGGHNFIGKVTDPNGNEVPVEVKD
NGNGTYDMTYIPQVPGKHKVEVFYEDKQLKQSPCEALINPAKADPTYTYADGAGVQECNA
GTGPVEFVIHSVNKANVPVPSSTEDFKVIVRDPKGEELPVEIKNNEDGTYTGSYTPVPGI
DTVFITLDGKAIKDAPYKCKVFQDPTTACIGESYAFGPGVDGNISIDKSPVFRIQGVTPE
GKKCEKGGDTFVVVVKNPEGKEQKPKVIDRGNGKYDVKYKAKVPGVYDVTVQLKDPENPE
EFKDIKGSVYHPEILDGVSAKKCTVTGQGIERPNDQVDNVFVITAKDYKGEDVKNGGHPF
QVVIDQVKESDKKKKKEKKESSSSSSSDSSEEEKEGEVDEDFAILHEEGEEVPAVQEEQQ
EENKEIEGKKVAQKEKGGIPCTVVDKEDGTYEVHYKAEAGQVRVKVTLNKEKVAKSPYYL
DIEEDADPDETGVENFCFVIQAKNRRGQVQADGKAKFAVDLEGPEGKVEGQTIVVKHLGE
GKYFISYTLPAVKGKYFINCKLNRRHIKGSPFKQTVN
Download sequence
Identical sequences A0A0A1TWZ5
XP_004185108.1.21224 jCVI|EIN_165800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]