SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384422802|ref|YP_005632161.1| from Vibrio cholerae LMA3984-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384422802|ref|YP_005632161.1|
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.85e-21
Family N-acetyl transferase, NAT 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384422802|ref|YP_005632161.1|
Sequence length 141
Comment acetyltransferase (putative) [Vibrio cholerae LMA3984-4]
Sequence
MEIKEFSACNLESLRKLYLDSRRDSFPWLKADSFRIEDFDRDSQGERIWLSEVLGNVAGF
ISIWEPDNFIHHLYVATEYQGQGVGSMLLNGAKMKYGNLSLKCMVQNQKALNFYLSQGFE
IVSQVDDELGGYYYMSFVAQT
Download sequence
Identical sequences A0A0H6KE71
WP_002045007.1.14353 WP_002045007.1.21179 WP_002045007.1.21279 WP_002045007.1.23134 WP_002045007.1.27822 WP_002045007.1.60216 WP_002045007.1.755 WP_002045007.1.75796 WP_002045007.1.78428 WP_002045007.1.87286 gi|384422802|ref|YP_005632161.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]