SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384423786|ref|YP_005633144.1| from Vibrio cholerae LMA3984-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384423786|ref|YP_005633144.1|
Domain Number 1 Region: 312-452
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.12e-23
Family Autoinducer synthetase 0.098
Further Details:      
 
Domain Number 2 Region: 61-249
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.00000353
Family Glycerol-3-phosphate (1)-acyltransferase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384423786|ref|YP_005633144.1|
Sequence length 586
Comment Putative hemolysin [Vibrio cholerae LMA3984-4]
Sequence
MLSTSPFVLPRKTPFGLGEHLAEWATGLKRLNQFYAQRPASGDTQAFLRFTLDVLGIDYQ
VVRGKLTHVPAQGATVVVANHPLGCVEGVILAELLLCIRSDVKILANQYLKLVPELASLF
IGVDVFEGADAAKANLHALRQAHKHLEQGGLLLMFPAGEVSQLVDSKQGRLEDKEWSQSV
SRLVKKHQAHTVPVYIDGHNSTPFYLAGKIHPMLRTLMLGRELLNKQHTQIGIAIGEGIS
HSEVQHLCDQQLVNYLRLNTYLLQSSPVRNKTASDRSLPPVAERLPLADLLEDIAQLPYA
DHMLRHNQFDVYCTTADNIPSLMHEIGRIRELNFREVGEGTGCALDIDRFDRDYLHLFIW
DREKNQLVGAYRLGLVDKLIEHKGISGLYSSTLFHYDQRFLNNMGNAIEMGRSVIDSQYQ
KSMAALLLLWKGIGTYVERHPQYTHLFGPVSISNDYSEQARRLLADTMTLHYYDSEQAEL
VMATNPLPTGQAQWNASLLTSLADLQLLSRVIARIDEGKGIPVLLRQYLGLNGKLVSFNV
DPAFNNALDGLIVVDLRNVPTKTLARYMGQSEALRYLATHQYFSDI
Download sequence
Identical sequences WP_000953510.1.21179 WP_000953510.1.23134 WP_000953510.1.60216 WP_000953510.1.69157 WP_000953510.1.75796 gi|384423786|ref|YP_005633144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]