SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384423970|ref|YP_005633328.1| from Vibrio cholerae LMA3984-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384423970|ref|YP_005633328.1|
Domain Number 1 Region: 4-247
Classification Level Classification E-value
Superfamily CutC-like 1.44e-70
Family CutC-like 0.00000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384423970|ref|YP_005633328.1|
Sequence length 254
Comment Cytoplasmic copper homeostasis protein cutC [Vibrio cholerae LMA3984-4]
Sequence
MKYQVEVCIDNIESLHNAIAGGATRIELCSSLALGGLTPSAGLMYSAGRVSPIPVYAMIR
PREGDFFYHDDELSIMAQDIRTAHQANLQGVVLGLLNADGTIDVKRSKPLIELAHSLGLG
VTFHRAFDHCVNPEHALEEIIALGCERILTSGLARNAYLGIERLAQLVKQSAGRISIMAG
AGVNAQNVAEIALATGVNELHLSAKTTRPSEMLFIRSESKMGAADCDDFIIPVTSRDALQ
QTVHALAALNSVLH
Download sequence
Identical sequences A0A085QPR8
WP_000877213.1.10874 WP_000877213.1.12828 WP_000877213.1.15919 WP_000877213.1.17001 WP_000877213.1.21179 WP_000877213.1.21279 WP_000877213.1.23361 WP_000877213.1.30045 WP_000877213.1.31964 WP_000877213.1.32942 WP_000877213.1.34133 WP_000877213.1.34663 WP_000877213.1.36364 WP_000877213.1.36956 WP_000877213.1.40346 WP_000877213.1.41569 WP_000877213.1.43222 WP_000877213.1.43407 WP_000877213.1.44136 WP_000877213.1.48659 WP_000877213.1.48874 WP_000877213.1.49593 WP_000877213.1.5028 WP_000877213.1.55208 WP_000877213.1.57098 WP_000877213.1.67839 WP_000877213.1.87625 WP_000877213.1.92412 WP_000877213.1.93441 WP_000877213.1.94827 WP_000877213.1.99861 gi|384423970|ref|YP_005633328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]