SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384424417|ref|YP_005633775.1| from Vibrio cholerae LMA3984-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384424417|ref|YP_005633775.1|
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.88e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384424417|ref|YP_005633775.1|
Sequence length 111
Comment PTS system cellobiose-specific transporter subunit IIA [Vibrio cholerae LMA3984-4]
Sequence
MEQELIVMEIICNAGEARSLCYEALRLARTRSFEQAEEKLCQAKECLNRAHLIQTQLIEA
DQGEGKVPMTLVMVHAQDHLMTTILAQEMATEMVALHKHLAGEEAKCLEMH
Download sequence
Identical sequences A0A085Q2P6 A0A0H3ALR5 A0A0H3Q1F5 A0A0K9UX24 A0A0X1KW82 C3LLX9 Q9KSH3
243277.VC1283 345073.VC0395_A0902 579112.VCM66_1238 593588.VCD_003067 gi|229608149|ref|YP_002878797.1| gi|15641296|ref|NP_230928.1| gi|227081455|ref|YP_002810006.1| IDP01307 gi|147675200|ref|YP_001216848.1| gi|384424417|ref|YP_005633775.1| gi|147675200|ref|YP_001216848.1| NP_230928.1.72393 WP_000434480.1.100264 WP_000434480.1.100388 WP_000434480.1.100440 WP_000434480.1.100659 WP_000434480.1.10071 WP_000434480.1.100924 WP_000434480.1.100976 WP_000434480.1.101117 WP_000434480.1.10121 WP_000434480.1.101220 WP_000434480.1.101314 WP_000434480.1.101507 WP_000434480.1.101677 WP_000434480.1.101933 WP_000434480.1.102054 WP_000434480.1.1024 WP_000434480.1.10453 WP_000434480.1.10626 WP_000434480.1.10834 WP_000434480.1.10887 WP_000434480.1.11270 WP_000434480.1.11700 WP_000434480.1.11879 WP_000434480.1.11885 WP_000434480.1.11965 WP_000434480.1.12252 WP_000434480.1.12262 WP_000434480.1.12332 WP_000434480.1.12486 WP_000434480.1.12525 WP_000434480.1.12527 WP_000434480.1.12548 WP_000434480.1.12590 WP_000434480.1.12686 WP_000434480.1.12828 WP_000434480.1.13053 WP_000434480.1.13155 WP_000434480.1.13156 WP_000434480.1.13395 WP_000434480.1.13454 WP_000434480.1.13652 WP_000434480.1.13725 WP_000434480.1.14080 WP_000434480.1.14179 WP_000434480.1.14257 WP_000434480.1.14263 WP_000434480.1.14353 WP_000434480.1.14904 WP_000434480.1.14995 WP_000434480.1.15109 WP_000434480.1.15134 WP_000434480.1.15179 WP_000434480.1.15200 WP_000434480.1.15516 WP_000434480.1.15786 WP_000434480.1.15919 WP_000434480.1.15997 WP_000434480.1.16057 WP_000434480.1.16115 WP_000434480.1.16351 WP_000434480.1.16382 WP_000434480.1.17001 WP_000434480.1.17232 WP_000434480.1.17295 WP_000434480.1.17621 WP_000434480.1.17738 WP_000434480.1.18375 WP_000434480.1.18392 WP_000434480.1.18447 WP_000434480.1.18484 WP_000434480.1.18577 WP_000434480.1.18862 WP_000434480.1.18916 WP_000434480.1.19126 WP_000434480.1.19128 WP_000434480.1.19428 WP_000434480.1.19442 WP_000434480.1.19503 WP_000434480.1.19597 WP_000434480.1.19924 WP_000434480.1.20065 WP_000434480.1.20107 WP_000434480.1.20336 WP_000434480.1.20379 WP_000434480.1.20404 WP_000434480.1.20595 WP_000434480.1.20602 WP_000434480.1.20669 WP_000434480.1.20699 WP_000434480.1.20758 WP_000434480.1.21073 WP_000434480.1.21179 WP_000434480.1.21281 WP_000434480.1.21558 WP_000434480.1.21671 WP_000434480.1.21717 WP_000434480.1.21764 WP_000434480.1.21815 WP_000434480.1.21866 WP_000434480.1.22521 WP_000434480.1.22770 WP_000434480.1.22773 WP_000434480.1.229 WP_000434480.1.22953 WP_000434480.1.2304 WP_000434480.1.23134 WP_000434480.1.2316 WP_000434480.1.23312 WP_000434480.1.23333 WP_000434480.1.23361 WP_000434480.1.2341 WP_000434480.1.23416 WP_000434480.1.23424 WP_000434480.1.23532 WP_000434480.1.23538 WP_000434480.1.2354 WP_000434480.1.23637 WP_000434480.1.23751 WP_000434480.1.23761 WP_000434480.1.23808 WP_000434480.1.23955 WP_000434480.1.240 WP_000434480.1.2401 WP_000434480.1.24106 WP_000434480.1.24280 WP_000434480.1.24345 WP_000434480.1.24399 WP_000434480.1.24980 WP_000434480.1.25073 WP_000434480.1.25649 WP_000434480.1.26020 WP_000434480.1.26156 WP_000434480.1.26223 WP_000434480.1.2627 WP_000434480.1.26326 WP_000434480.1.26508 WP_000434480.1.26580 WP_000434480.1.27186 WP_000434480.1.27435 WP_000434480.1.27458 WP_000434480.1.27532 WP_000434480.1.27639 WP_000434480.1.27822 WP_000434480.1.27863 WP_000434480.1.28431 WP_000434480.1.2849 WP_000434480.1.28508 WP_000434480.1.29095 WP_000434480.1.29535 WP_000434480.1.29708 WP_000434480.1.29889 WP_000434480.1.30045 WP_000434480.1.30107 WP_000434480.1.30292 WP_000434480.1.3032 WP_000434480.1.30360 WP_000434480.1.3054 WP_000434480.1.30927 WP_000434480.1.31096 WP_000434480.1.31396 WP_000434480.1.31718 WP_000434480.1.31964 WP_000434480.1.32264 WP_000434480.1.32271 WP_000434480.1.32395 WP_000434480.1.32814 WP_000434480.1.32942 WP_000434480.1.32955 WP_000434480.1.33019 WP_000434480.1.33093 WP_000434480.1.33625 WP_000434480.1.33811 WP_000434480.1.33819 WP_000434480.1.34108 WP_000434480.1.34133 WP_000434480.1.34195 WP_000434480.1.34261 WP_000434480.1.34634 WP_000434480.1.34643 WP_000434480.1.34663 WP_000434480.1.3514 WP_000434480.1.35201 WP_000434480.1.35266 WP_000434480.1.35630 WP_000434480.1.35880 WP_000434480.1.35881 WP_000434480.1.36322 WP_000434480.1.3635 WP_000434480.1.36354 WP_000434480.1.36364 WP_000434480.1.36384 WP_000434480.1.36441 WP_000434480.1.36513 WP_000434480.1.36668 WP_000434480.1.36686 WP_000434480.1.36874 WP_000434480.1.36973 WP_000434480.1.37054 WP_000434480.1.37260 WP_000434480.1.37262 WP_000434480.1.37537 WP_000434480.1.37676 WP_000434480.1.37784 WP_000434480.1.37999 WP_000434480.1.38420 WP_000434480.1.38590 WP_000434480.1.39460 WP_000434480.1.39514 WP_000434480.1.39675 WP_000434480.1.39853 WP_000434480.1.39933 WP_000434480.1.40039 WP_000434480.1.40152 WP_000434480.1.40346 WP_000434480.1.40433 WP_000434480.1.40459 WP_000434480.1.40470 WP_000434480.1.40484 WP_000434480.1.40491 WP_000434480.1.40542 WP_000434480.1.40571 WP_000434480.1.40740 WP_000434480.1.40782 WP_000434480.1.40862 WP_000434480.1.41284 WP_000434480.1.41573 WP_000434480.1.4175 WP_000434480.1.42128 WP_000434480.1.42152 WP_000434480.1.42441 WP_000434480.1.42498 WP_000434480.1.42617 WP_000434480.1.4272 WP_000434480.1.42783 WP_000434480.1.4284 WP_000434480.1.42853 WP_000434480.1.42865 WP_000434480.1.42885 WP_000434480.1.43222 WP_000434480.1.43335 WP_000434480.1.43407 WP_000434480.1.43428 WP_000434480.1.4365 WP_000434480.1.43884 WP_000434480.1.439 WP_000434480.1.44136 WP_000434480.1.44555 WP_000434480.1.44569 WP_000434480.1.44709 WP_000434480.1.44730 WP_000434480.1.45055 WP_000434480.1.45127 WP_000434480.1.45155 WP_000434480.1.45206 WP_000434480.1.45264 WP_000434480.1.45372 WP_000434480.1.45704 WP_000434480.1.45842 WP_000434480.1.45903 WP_000434480.1.45958 WP_000434480.1.46118 WP_000434480.1.46146 WP_000434480.1.46540 WP_000434480.1.4661 WP_000434480.1.47202 WP_000434480.1.4730 WP_000434480.1.4731 WP_000434480.1.47417 WP_000434480.1.47428 WP_000434480.1.47736 WP_000434480.1.47794 WP_000434480.1.47796 WP_000434480.1.47846 WP_000434480.1.47942 WP_000434480.1.48128 WP_000434480.1.48305 WP_000434480.1.48659 WP_000434480.1.48715 WP_000434480.1.488 WP_000434480.1.48874 WP_000434480.1.48927 WP_000434480.1.48984 WP_000434480.1.49238 WP_000434480.1.49317 WP_000434480.1.49593 WP_000434480.1.50254 WP_000434480.1.50277 WP_000434480.1.5028 WP_000434480.1.50577 WP_000434480.1.50625 WP_000434480.1.50813 WP_000434480.1.50822 WP_000434480.1.50980 WP_000434480.1.51160 WP_000434480.1.51163 WP_000434480.1.51177 WP_000434480.1.51661 WP_000434480.1.5201 WP_000434480.1.52391 WP_000434480.1.52676 WP_000434480.1.53085 WP_000434480.1.5320 WP_000434480.1.53214 WP_000434480.1.53823 WP_000434480.1.5397 WP_000434480.1.54191 WP_000434480.1.5425 WP_000434480.1.54398 WP_000434480.1.5450 WP_000434480.1.54706 WP_000434480.1.54831 WP_000434480.1.54901 WP_000434480.1.55092 WP_000434480.1.55208 WP_000434480.1.55665 WP_000434480.1.55832 WP_000434480.1.55917 WP_000434480.1.55929 WP_000434480.1.55932 WP_000434480.1.56429 WP_000434480.1.56785 WP_000434480.1.56807 WP_000434480.1.57098 WP_000434480.1.57148 WP_000434480.1.57300 WP_000434480.1.57518 WP_000434480.1.57546 WP_000434480.1.57678 WP_000434480.1.57751 WP_000434480.1.57945 WP_000434480.1.58295 WP_000434480.1.58367 WP_000434480.1.58596 WP_000434480.1.58844 WP_000434480.1.58975 WP_000434480.1.59010 WP_000434480.1.59194 WP_000434480.1.59378 WP_000434480.1.59394 WP_000434480.1.5943 WP_000434480.1.59554 WP_000434480.1.59633 WP_000434480.1.59741 WP_000434480.1.59916 WP_000434480.1.60216 WP_000434480.1.60386 WP_000434480.1.60633 WP_000434480.1.60694 WP_000434480.1.60800 WP_000434480.1.60955 WP_000434480.1.61169 WP_000434480.1.61523 WP_000434480.1.61644 WP_000434480.1.61753 WP_000434480.1.61869 WP_000434480.1.61875 WP_000434480.1.61935 WP_000434480.1.62165 WP_000434480.1.62324 WP_000434480.1.62425 WP_000434480.1.62763 WP_000434480.1.63347 WP_000434480.1.63546 WP_000434480.1.63655 WP_000434480.1.6366 WP_000434480.1.63723 WP_000434480.1.63749 WP_000434480.1.63779 WP_000434480.1.63911 WP_000434480.1.64033 WP_000434480.1.64201 WP_000434480.1.64253 WP_000434480.1.64315 WP_000434480.1.64382 WP_000434480.1.64441 WP_000434480.1.65007 WP_000434480.1.65051 WP_000434480.1.65086 WP_000434480.1.65469 WP_000434480.1.65528 WP_000434480.1.66329 WP_000434480.1.66459 WP_000434480.1.66633 WP_000434480.1.66696 WP_000434480.1.67616 WP_000434480.1.67770 WP_000434480.1.67839 WP_000434480.1.68424 WP_000434480.1.68506 WP_000434480.1.68723 WP_000434480.1.68925 WP_000434480.1.69049 WP_000434480.1.69085 WP_000434480.1.69157 WP_000434480.1.69530 WP_000434480.1.69843 WP_000434480.1.69857 WP_000434480.1.70069 WP_000434480.1.70176 WP_000434480.1.70222 WP_000434480.1.70247 WP_000434480.1.7049 WP_000434480.1.70775 WP_000434480.1.70813 WP_000434480.1.70892 WP_000434480.1.71129 WP_000434480.1.72106 WP_000434480.1.72241 WP_000434480.1.72326 WP_000434480.1.72328 WP_000434480.1.72361 WP_000434480.1.72369 WP_000434480.1.7238 WP_000434480.1.72480 WP_000434480.1.72856 WP_000434480.1.73148 WP_000434480.1.73297 WP_000434480.1.73429 WP_000434480.1.73555 WP_000434480.1.73855 WP_000434480.1.73929 WP_000434480.1.74111 WP_000434480.1.74503 WP_000434480.1.7460 WP_000434480.1.74666 WP_000434480.1.74991 WP_000434480.1.75012 WP_000434480.1.75326 WP_000434480.1.75378 WP_000434480.1.755 WP_000434480.1.75778 WP_000434480.1.75796 WP_000434480.1.76320 WP_000434480.1.76425 WP_000434480.1.76486 WP_000434480.1.7654 WP_000434480.1.76645 WP_000434480.1.77029 WP_000434480.1.7717 WP_000434480.1.77355 WP_000434480.1.77397 WP_000434480.1.77445 WP_000434480.1.77703 WP_000434480.1.77794 WP_000434480.1.77830 WP_000434480.1.77914 WP_000434480.1.78157 WP_000434480.1.78172 WP_000434480.1.78428 WP_000434480.1.78531 WP_000434480.1.78740 WP_000434480.1.79044 WP_000434480.1.79776 WP_000434480.1.79943 WP_000434480.1.80024 WP_000434480.1.8023 WP_000434480.1.80339 WP_000434480.1.80500 WP_000434480.1.80618 WP_000434480.1.80628 WP_000434480.1.80702 WP_000434480.1.80744 WP_000434480.1.80808 WP_000434480.1.80909 WP_000434480.1.8117 WP_000434480.1.81563 WP_000434480.1.81871 WP_000434480.1.81917 WP_000434480.1.82030 WP_000434480.1.82119 WP_000434480.1.82193 WP_000434480.1.82248 WP_000434480.1.82262 WP_000434480.1.82413 WP_000434480.1.82583 WP_000434480.1.83040 WP_000434480.1.83073 WP_000434480.1.83082 WP_000434480.1.83109 WP_000434480.1.83703 WP_000434480.1.83761 WP_000434480.1.84385 WP_000434480.1.84519 WP_000434480.1.84610 WP_000434480.1.8480 WP_000434480.1.85007 WP_000434480.1.85086 WP_000434480.1.85388 WP_000434480.1.85498 WP_000434480.1.85822 WP_000434480.1.85878 WP_000434480.1.85961 WP_000434480.1.85972 WP_000434480.1.85998 WP_000434480.1.86057 WP_000434480.1.86192 WP_000434480.1.86269 WP_000434480.1.86874 WP_000434480.1.86879 WP_000434480.1.87274 WP_000434480.1.87286 WP_000434480.1.87301 WP_000434480.1.87335 WP_000434480.1.87355 WP_000434480.1.87573 WP_000434480.1.87602 WP_000434480.1.87625 WP_000434480.1.87804 WP_000434480.1.88057 WP_000434480.1.88283 WP_000434480.1.88292 WP_000434480.1.88350 WP_000434480.1.88556 WP_000434480.1.8867 WP_000434480.1.89144 WP_000434480.1.89441 WP_000434480.1.89447 WP_000434480.1.89719 WP_000434480.1.89822 WP_000434480.1.89889 WP_000434480.1.8997 WP_000434480.1.89995 WP_000434480.1.90133 WP_000434480.1.90227 WP_000434480.1.9040 WP_000434480.1.90437 WP_000434480.1.90675 WP_000434480.1.90774 WP_000434480.1.90889 WP_000434480.1.91247 WP_000434480.1.91262 WP_000434480.1.91274 WP_000434480.1.91539 WP_000434480.1.91747 WP_000434480.1.91794 WP_000434480.1.91841 WP_000434480.1.92038 WP_000434480.1.92063 WP_000434480.1.92069 WP_000434480.1.92157 WP_000434480.1.92322 WP_000434480.1.92401 WP_000434480.1.92412 WP_000434480.1.92516 WP_000434480.1.92559 WP_000434480.1.92632 WP_000434480.1.92696 WP_000434480.1.92703 WP_000434480.1.92952 WP_000434480.1.92993 WP_000434480.1.9302 WP_000434480.1.93060 WP_000434480.1.93399 WP_000434480.1.93441 WP_000434480.1.93836 WP_000434480.1.93945 WP_000434480.1.94255 WP_000434480.1.94426 WP_000434480.1.94441 WP_000434480.1.94481 WP_000434480.1.94827 WP_000434480.1.94887 WP_000434480.1.95204 WP_000434480.1.95516 WP_000434480.1.95549 WP_000434480.1.9561 WP_000434480.1.95662 WP_000434480.1.95733 WP_000434480.1.95818 WP_000434480.1.95976 WP_000434480.1.96001 WP_000434480.1.9607 WP_000434480.1.96089 WP_000434480.1.96187 WP_000434480.1.96311 WP_000434480.1.96471 WP_000434480.1.9660 WP_000434480.1.96687 WP_000434480.1.96693 WP_000434480.1.96704 WP_000434480.1.96980 WP_000434480.1.97100 WP_000434480.1.97144 WP_000434480.1.97288 WP_000434480.1.97405 WP_000434480.1.97516 WP_000434480.1.97552 WP_000434480.1.97650 WP_000434480.1.97799 WP_000434480.1.97832 WP_000434480.1.9787 WP_000434480.1.98021 WP_000434480.1.98116 WP_000434480.1.98172 WP_000434480.1.98246 WP_000434480.1.98280 WP_000434480.1.98373 WP_000434480.1.98619 WP_000434480.1.98624 WP_000434480.1.98642 WP_000434480.1.99128 WP_000434480.1.99204 WP_000434480.1.9939 WP_000434480.1.99417 WP_000434480.1.99452 WP_000434480.1.995 WP_000434480.1.99861 WP_000434480.1.99872 WP_000434480.1.99949 WP_000434480.1.99992 gi|360035182|ref|YP_004936945.1| gi|379741093|ref|YP_005333062.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]