SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384425207|ref|YP_005634565.1| from Vibrio cholerae LMA3984-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384425207|ref|YP_005634565.1|
Domain Number 1 Region: 15-230
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.77e-63
Family PP-loop ATPase 0.00000334
Further Details:      
 
Domain Number 2 Region: 321-433
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.37e-27
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.00049
Further Details:      
 
Domain Number 3 Region: 233-317
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 6.15e-23
Family MesJ substrate recognition domain-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384425207|ref|YP_005634565.1|
Sequence length 440
Comment tRNA(Ile)-lysidine synthetase [Vibrio cholerae LMA3984-4]
Sequence
MDDLYLHFVQQLARYPFRKILLALSGGVDSRVLLALLARGRDEFGWDVAAVHVHHGLSPN
ADQWAQHCQRCCREVGMACQIEYVQLDVASGESIEKLAREARYRVLAPHVNAQTLLLLGQ
HADDQLETFLLALKRGSGPKGLAAMAAYAPFAEGHLLRPLLTVSRQHIEAYAKQHKLTWV
IDESNADIRYERNFLRHQVTPVLTERWPSIRQAVQRSAELCAEQEALLQEFLAGALKKAI
TAEGGLSIAVLAEGSEGMRRQLIRAWFAHHRLPMPSRQHTERIWCEVALASEDANPKLKL
NKIEVRRFQHCLYLVPPERDLSGWRSALVPEQRLPLPQGLGHLQLTSKAGGNIKLPDDPS
QLWVSFEPQGLEACPVGRVGSRKLKKLFQEYGVPSWRRRQTPILMYQNRVVCVADLFVDR
DWSGQDCELVWFKSHDSVPK
Download sequence
Identical sequences WP_000342517.1.21179 gi|384425207|ref|YP_005634565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]