SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347531733|ref|YP_004838496.1| from Roseburia hominis A2-183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347531733|ref|YP_004838496.1|
Domain Number 1 Region: 1-34
Classification Level Classification E-value
Superfamily L28p-like 0.0000000139
Family Ribosomal protein L28 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347531733|ref|YP_004838496.1|
Sequence length 35
Comment hypothetical protein RHOM_07255, partial [Roseburia hominis A2-183]
Sequence
MWKSNIKRVSCKVNGTPKKLYVCASCLKSGKVERA
Download sequence
Identical sequences D4KXA8 G2T3J3
gi|347531733|ref|YP_004838496.1| gi|479147346|ref|YP_007777775.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]