SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347532198|ref|YP_004838961.1| from Roseburia hominis A2-183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347532198|ref|YP_004838961.1|
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily L28p-like 5.1e-27
Family Ribosomal protein L31p 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347532198|ref|YP_004838961.1|
Sequence length 68
Comment 50S ribosomal protein L31 [Roseburia hominis A2-183]
Sequence
MKAGIHPDYYQATVTCNCGNTFVTGSTKEDIHVEICSKCHPFYTGQQKAAQARGRIDKFN
KKYGMQQQ
Download sequence
Identical sequences A0A174FVC5 G2SXB5
WP_014080066.1.73573 gi|347532198|ref|YP_004838961.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]