SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Amore1|137831|estExt_Genewise1Plus.C_4_t30410 from Amorphotheca resinae v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Amore1|137831|estExt_Genewise1Plus.C_4_t30410
Domain Number 1 Region: 42-180
Classification Level Classification E-value
Superfamily E set domains 0.0000147
Family Arrestin/Vps26-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Amore1|137831|estExt_Genewise1Plus.C_4_t30410
Sequence length 605
Sequence
MPSFNPFGGVTGRTCATLFEIRLENEVIVLRGAENEASSQLLRGVVVLCLPAALKVEDVH
LRMTGQLKVGWNDQRMSAAGISHNRVEKTTEIFNHKWAPFVGGVGPGSSSRGTLLPSGNY
EWPFELVIPGSMAESVEGLHDSHIVYKLKATVARGKLAYDLHTWKPVRIVRTLDPAALEL
THAMTVENIWPNKIEYQLIIPQKAIVFGTAIHVSMRFTSLLKGLRIGTIKCVLVESQEFV
IPGATVHTERFWKHSRDVNSWTFELNDEEHYHDVLDESGQDGYTLNEMMPLPKRLSKCVQ
DVDVHGIKIRHKVKFNIALHNPDGHVSELRATLPVTIFISPNMPIDADGCLIDQTPLSSQ
SVDVASHAPPLYGEHVLDQLYADIDQSGLMTPAPQSGMNTPFYNLSRHGSSENLASLDGA
VHPTGAVPPAALSSRLQNLNTSSRNSSFQRRHPVLGSGGNTPHHGPHGENDSGYFDHHHH
SASHSTVLSGRTSEEDEHHGGLSNLASGQHTPEHIDYSDLGDLSKVPSYSTAVRAPIRST
TYSESLPNYEAAVSVPPSPNRAFSTPTSPLVGSPEIGIRRPPPAHVGDFEERRRLHLLTP
RERAS
Download sequence
Identical sequences jgi|Amore1|137831|estExt_Genewise1Plus.C_4_t30410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]