SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Amore1|145284|estExt_Genewise1Plus.C_10_t30109 from Amorphotheca resinae v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Amore1|145284|estExt_Genewise1Plus.C_10_t30109
Domain Number 1 Region: 41-764
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.27e-253
Family Motor proteins 0.0000000000754
Further Details:      
 
Domain Number 2 Region: 1054-1144
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-23
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Amore1|145284|estExt_Genewise1Plus.C_10_t30109
Sequence length 1228
Sequence
MGITTRRNQKAAASNAPTGGGGRSGGASKPNIKKATFDTTKKKEVGVSDLTLLSKVSNEA
INENLQKRFENREIYTYIGHVLVSVNPFRDLGIYTDEVLDSYKGKNRLEMPPHVFAIAES
AYYNMNAYKDNQCVIISGESGAGKTEAAKRIMQYIANVSGGSNSSIQHTKDMVLATNPLL
ESFGNAKTLRNNNSSRFGKYLQLQFNAQGEPVGATITNYLLEKSRVVGQIKDERNFHIFY
QFTKGASQEYRTNYGVQKPETYLYTSRSKCFDVDGIDDIADYKETLNAMKVIGLSQAEQD
EIFRMLAAILWTGNIQFVEDKDGYAAIADQSVVDFLAYLLEVSPEHVIQAITIRILTPRS
GEVIESPANPAQAMATRDALAKAIYNNLFDWIVERVNVSLKARGATSNSIGILDIYGFEI
FERNSFEQLCINYVNEKLQQIFIQLTLKTEQEEYAREQIQWTPIKYFDNKIVCDLIESTR
PPGVFSALKDATKTAHADPAACDRTFMQAINGMSNPHLTPRQGSFIIKHYAGDVSYTVDG
ITDKNKDQLLKGLLNLFGQSSNTFVHTLFPHEVDQDNRKAPPSAGDKIKASANDLVATLM
KAQPSYIRTIKPNENKSPTEYNVPNVLHQIKYLGLQENVRIRRAGFAYRQTFDKFVERFY
LLSPQTSYAGDYTWTGDAKSGAKQIMKDTSIPADEFQMGVTKAFIKAPETLFALEHMRDR
YWHNMAIRIQRVWRAYLRIRVEAATRIQRLWRKKKVGAQFLALRERGHKVLQGKKERRRF
SLLGSRRFMGDYLGISATSGPGSRIRSAINLAANEVVIFSCRGEILESKFAKTSKPSPRI
FVVTKSKFYIVTQLLVNKQIQIAVQRAIPLSTIKFVGTSNCRDDWFSLGVGSPQEPDPLL
NCLLKTELFTHMQIAMPGSFRLNIGSSIEYAKKPGKMQVIKVVKDSTTAQDFYKSQTIHT
SAGEPPNSVSRPMPKSKPVPAKPFTKGRLIKPGGPGGRPSRITANRNTKPVSKPDPPAAP
HQRNASNASQQMASPIPNHTRNVSSISSARAVPPPPPPAPPAQPREPQYRVLYDFVGQSS
NEISLRKDDLITIIQKENNGWWLAKTSAGQGWAPSAYLKEEAPPAAPIVKPTPPPPPPVA
PKVNGVNGAAAARSKPTPPAPPAKRPAAGRKPAPPPAPRDSGMSMNSSNGTDSGRNTPNP
SLAGGLAEALRARQNAMQKGQDDDDDDW
Download sequence
Identical sequences jgi|Amore1|145284|estExt_Genewise1Plus.C_10_t30109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]