SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Amore1|147621|estExt_Genewise1Plus.C_13_t20008 from Amorphotheca resinae v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Amore1|147621|estExt_Genewise1Plus.C_13_t20008
Domain Number 1 Region: 22-137
Classification Level Classification E-value
Superfamily E set domains 0.0000448
Family Arrestin/Vps26-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Amore1|147621|estExt_Genewise1Plus.C_13_t20008
Sequence length 518
Sequence
MSYAVSVQTTTATIASYARKMTQSSRPGVEIILHNHSAGKAYTTFDEITGRVNITSSHNV
RFDEIRITLEGTTKTFIDNLPTTGTTSRKVAYHNWLKLPMPIRDTDYPQPRVLESGRTYT
FPFNFNIPAQLLPRACSHSVAADHVHQAHLQLPPSMGDREVSQHDDLSPEMTRISYAIKA
KVIRYREEDEKEAVLVEGLKKLCVVPAVVEAPPLSIVDGNRDYVLSKTKLLKKGVFSGKL
GRITVSADQTNAIILPSPASPSTSPATTMATLNIRFEPHDVTFEPPKLGSLTTKIKAITF
YNVIPAQALPCTFFVTALDEATRGIYHTSIPLSSRRVTSVAWTKHEPEVTDTRRDSDSST
NSSYSSDRVLSPVQESAVYYTATVLVPITLPSSKTWIPTFHSCTVSRIYTLDISLTIHTP
GAGVPASSASLHLPVQIAAAGNQTQRLELTASEAAAELARVDEFFAPRMLEIPSEEFLEN
SVLRPAASIAPATTTPDLPPRYENFFSQTRAVVNPKRR
Download sequence
Identical sequences jgi|Amore1|147621|estExt_Genewise1Plus.C_13_t20008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]