SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Amore1|16937|gm1.2606_g from Amorphotheca resinae v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Amore1|16937|gm1.2606_g
Domain Number 1 Region: 574-603,639-673
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000392
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Amore1|16937|gm1.2606_g
Sequence length 831
Sequence
MPGPKATKVGHFLAKALAIKLDYRNELDEEIRRGESVFSTQTADTYVEEEPTTGEFLREV
IPDRHDVARYFISLFPFLTWITHYNLQWFLGDLVAGITIGCVVVPQGMAYATLAGLPPQF
GLYSSFMGVLVYWFFATSKDITIGPVAVMSTLVGDVLTRAKETHPDIPGHEIASALSVIA
GCIIFFIGLVRCGWIVDLIPLVSISAFMTGSALNIASGQVAGLMGISKVNTRDPTYWVII
HTLQGLPRTSLDAAMGLTALFLLYGIRSVCKFAAKKFPRRQKLIFFCATLRTVFVILLYT
LVSWLVNRHHRQHPKFKVLGKVPRGFKAAAVPTITKPMITIFATDLPASVIVLLIEHIAI
SKSFGRVNNYIINPSQELVGIGVTNILGPFLGAYPATGSFSRTAIKSKAGVRTPFAGLIT
AIVVLLAIYALPAVFFYIPNATLSAVIIHAVGDLITSPNTVYQFWRVAPLDVLIFFIGVI
VTVFSSIENGIYTTICVSFAVLMFRIIKAKGRFLGKVKVHSVIGDQVLNDSNKPLAENGT
FPKSADVDDGGARALFLPIDHGDGSNPEVDIVNPYPGIFIYRFSEGFNYPNANHYLDQLT
NHIFAKTRRTNLNHYARPGDRPWNDPGPRHGKVPEDHANRPTLKAIILDFSSVNNVDVTS
VQQLIDVRNQLDRYTAPAVVDWHFTSINNRWTKRALVSAGFGYPTPDRGDGTLTRWKPIF
SVAEIGGSDSAAAVAEAANNEKELQAQRTRSRRTGDPTSPDSDSGISASDLKTNVGVRTL
GRTAVVNGINRPLFHIDLTSALQSAVANVKAREAAEAEFEARGGEGIGEEP
Download sequence
Identical sequences jgi|Amore1|16937|gm1.2606_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]