SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Amore1|48653|fgenesh1_pm.3_#_305 from Amorphotheca resinae v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Amore1|48653|fgenesh1_pm.3_#_305
Domain Number 1 Region: 53-210
Classification Level Classification E-value
Superfamily E set domains 0.000000105
Family Arrestin/Vps26-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Amore1|48653|fgenesh1_pm.3_#_305
Sequence length 824
Sequence
MCADVTPTSSSSPSPSPFASTGRSFLSRLTLPLKSRTRNLADFHIRPDEPYRQYSPGDLV
KGAVVLTVVKPIRVTHLTVCLHGFARIFKHPNGANEPLPVDVVNRASTGRRRVQYFGDGY
VSLFQDEVTLCGEGRLESGIYNFNFELEFPSKGLPTSIDFERGTISYMITSTITRPTSMA
ATSSCDKKLSLVETVDIGPMTPPKPRTISLEPISRRMRRRRTVKSKESSSQDASSELGSR
TEAKRTAASPHPDESASQCGSTDHSVNRRSPVPSDILSTVSAATGTESTTSSSSEPSFGL
GPAPSSAKSKRGSQCDSNSTFADKTITATIELLKSGCLPGDSLPLKISIKHTKAIKSLHG
IIITLYRQGRIDSAPPLSLFVDIKGKAAEKMKHDEYYPKSKTGLAGLSLSSAGSSSLFRK
DLSQTFAPIIVDPSTLTAVVNASVRVPEDVFPTICGVPGDMISFKYHVEVVVDLGGKLAG
QQRHLPRVGMVTHPSNYGNAGGGRGDVQPNMLATWGGSIVDTDQVRREKSVVACLFEVIV
GTTDSARKRGRGSRSVRREINDWPEEVPVTPSTRNDPIYEEPSRPNDAEDNGVEQYPHQY
HEQSYEDRYPNYYPNDGYNYQQNYDSSNDLYPPPSHTQIPVPPPELEEEEGLDEKERVRR
AEERLLPSQPPPDLNDVPSSSRTIIPPSVPSIPDEDDLYSASDAMPPPVSSTTQPPPPSS
PFPDALSPFAPALEDLTPHASSTEDKQELERRRLLAEASAPTDFHADEEDDNAGEGSSSA
VQLEPSAPILTEDEEEGGYGASYFHHPHHHHTMPGEETLPRYER
Download sequence
Identical sequences jgi|Amore1|48653|fgenesh1_pm.3_#_305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]